BLASTX nr result
ID: Salvia21_contig00032843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00032843 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517583.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002517583.1| conserved hypothetical protein [Ricinus communis] gi|223543215|gb|EEF44747.1| conserved hypothetical protein [Ricinus communis] Length = 634 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -1 Query: 141 DGFDVVDDLSEPTMGEKLASLNLEGNDNAPNPENADSSLLAKPPSAD 1 +G V DD++EPTMGEKLASLNL+ ND + E +S AKPPSAD Sbjct: 406 NGVLVEDDVNEPTMGEKLASLNLQDNDKTKDQEKPESPPHAKPPSAD 452