BLASTX nr result
ID: Salvia21_contig00032687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00032687 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-lik... 151 5e-35 ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus commun... 150 1e-34 ref|XP_002873774.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata... 148 4e-34 ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|111354... 147 9e-34 ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycin... 146 2e-33 >ref|XP_004139092.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] gi|449476195|ref|XP_004154668.1| PREDICTED: thioredoxin F2, chloroplastic-like [Cucumis sativus] Length = 180 Score = 151 bits (382), Expect = 5e-35 Identities = 70/82 (85%), Positives = 79/82 (96%) Frame = +3 Query: 3 MYTQWCGPCKVMAPKFQELSEKHEDIVFLKLDCNQENKPLAKELGIKVVPTFKILKDEKV 182 MYTQWCGPCKVMAPKFQ+LSEK+ D+VFLKLDCN +NKPLAKELGIKVVPTFKILKD+KV Sbjct: 99 MYTQWCGPCKVMAPKFQDLSEKYLDVVFLKLDCNIDNKPLAKELGIKVVPTFKILKDKKV 158 Query: 183 IKEVTGAKFDDLVHAIEAARST 248 +KEVTGAKFD+LVHAI+A RS+ Sbjct: 159 VKEVTGAKFDELVHAIDAVRSS 180 >ref|XP_002514830.1| thioredoxin f-type, putative [Ricinus communis] gi|223545881|gb|EEF47384.1| thioredoxin f-type, putative [Ricinus communis] Length = 186 Score = 150 bits (379), Expect = 1e-34 Identities = 69/82 (84%), Positives = 78/82 (95%) Frame = +3 Query: 3 MYTQWCGPCKVMAPKFQELSEKHEDIVFLKLDCNQENKPLAKELGIKVVPTFKILKDEKV 182 MYTQWCGPCK+MAPKFQ+LSEK+ D+VFLKLDCNQ+NKPLAKELGI+VVPTFKILKD KV Sbjct: 105 MYTQWCGPCKIMAPKFQQLSEKYLDVVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKV 164 Query: 183 IKEVTGAKFDDLVHAIEAARST 248 +KEVTG+KFDDLV AIEA RS+ Sbjct: 165 VKEVTGSKFDDLVAAIEAVRSS 186 >ref|XP_002873774.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] gi|297319611|gb|EFH50033.1| ATF2/TRXF2 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 148 bits (374), Expect = 4e-34 Identities = 68/81 (83%), Positives = 79/81 (97%) Frame = +3 Query: 3 MYTQWCGPCKVMAPKFQELSEKHEDIVFLKLDCNQENKPLAKELGIKVVPTFKILKDEKV 182 MYTQWCGPCKV+APK++ELSEK++D+VFLKLDCNQENKPLAKELGI+VVPTFKILKD KV Sbjct: 105 MYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQENKPLAKELGIRVVPTFKILKDNKV 164 Query: 183 IKEVTGAKFDDLVHAIEAARS 245 +KEVTGAK++DL+ AIEAARS Sbjct: 165 VKEVTGAKYEDLLAAIEAARS 185 >ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Length = 185 Score = 147 bits (371), Expect = 9e-34 Identities = 67/81 (82%), Positives = 79/81 (97%) Frame = +3 Query: 3 MYTQWCGPCKVMAPKFQELSEKHEDIVFLKLDCNQENKPLAKELGIKVVPTFKILKDEKV 182 MYTQWCGPCKV+APK++ELSEK++D+VFLKLDCNQ+NKPLAKELGI+VVPTFKILKD KV Sbjct: 104 MYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKV 163 Query: 183 IKEVTGAKFDDLVHAIEAARS 245 +KEVTGAK++DL+ AIEAARS Sbjct: 164 VKEVTGAKYEDLLAAIEAARS 184 >ref|NP_001236670.1| uncharacterized protein LOC100306555 [Glycine max] gi|255628867|gb|ACU14778.1| unknown [Glycine max] Length = 179 Score = 146 bits (368), Expect = 2e-33 Identities = 68/82 (82%), Positives = 76/82 (92%) Frame = +3 Query: 3 MYTQWCGPCKVMAPKFQELSEKHEDIVFLKLDCNQENKPLAKELGIKVVPTFKILKDEKV 182 MYTQWCGPCKVMAPKFQELSEK+ D+VFLKLDCNQ+N+PLA ELGIKVVPTFKILKD KV Sbjct: 98 MYTQWCGPCKVMAPKFQELSEKYLDVVFLKLDCNQDNRPLAIELGIKVVPTFKILKDNKV 157 Query: 183 IKEVTGAKFDDLVHAIEAARST 248 +KEVTGAK+DDLV AI+ RS+ Sbjct: 158 VKEVTGAKYDDLVDAIDKVRSS 179