BLASTX nr result
ID: Salvia21_contig00032656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00032656 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521224.1| Monoglyceride lipase, putative [Ricinus comm... 73 2e-11 ref|XP_003636968.1| Monoglyceride lipase [Medicago truncatula] g... 69 4e-10 ref|XP_002280343.2| PREDICTED: uncharacterized protein LOC100261... 69 5e-10 emb|CBI33650.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002329285.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 >ref|XP_002521224.1| Monoglyceride lipase, putative [Ricinus communis] gi|223539589|gb|EEF41176.1| Monoglyceride lipase, putative [Ricinus communis] Length = 375 Score = 73.2 bits (178), Expect = 2e-11 Identities = 40/81 (49%), Positives = 54/81 (66%) Frame = +2 Query: 86 MALKSTEIYERRLFYVKPKISPARRKSEREVRVMSNPVKFEDVSEELQKILDADMDQAGP 265 MALKS ++Y R + + +K ++ + V+F + ELQKILDA+MD+A Sbjct: 1 MALKSGKVYGRHCSLLHGIVCLEGKKGKKRGAM----VRFAGIDNELQKILDANMDEARA 56 Query: 266 RRRAREAFKHIQLSIDHILFK 328 RRRAR+AFKHIQL+IDHILFK Sbjct: 57 RRRARDAFKHIQLNIDHILFK 77 >ref|XP_003636968.1| Monoglyceride lipase [Medicago truncatula] gi|355502903|gb|AES84106.1| Monoglyceride lipase [Medicago truncatula] Length = 380 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +2 Query: 167 EREVRVMSNPVKFEDVSEELQKILDADMDQAGPRRRAREAFKHIQLSIDHILFK 328 EREV+ ++ +F V ELQKILDA+MD RR+AREAFK +QL IDHILFK Sbjct: 27 EREVKTLAMATRFPGVDNELQKILDANMDHVSARRQAREAFKDVQLGIDHILFK 80 >ref|XP_002280343.2| PREDICTED: uncharacterized protein LOC100261782 [Vitis vinifera] Length = 409 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = +2 Query: 158 RKSEREVRVMSNPVKFEDVSEELQKILDADMDQAGPRRRAREAFKHIQLSIDHILFK 328 RK + M+ K E V +ELQKILDA MD+A RRRAREAFK IQL IDH+LFK Sbjct: 54 RKGRKRREPMAPAAKLEGVDKELQKILDAKMDEAPARRRAREAFKEIQLGIDHLLFK 110 >emb|CBI33650.3| unnamed protein product [Vitis vinifera] Length = 492 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = +2 Query: 158 RKSEREVRVMSNPVKFEDVSEELQKILDADMDQAGPRRRAREAFKHIQLSIDHILFK 328 RK + M+ K E V +ELQKILDA MD+A RRRAREAFK IQL IDH+LFK Sbjct: 137 RKGRKRREPMAPAAKLEGVDKELQKILDAKMDEAPARRRAREAFKEIQLGIDHLLFK 193 >ref|XP_002329285.1| predicted protein [Populus trichocarpa] gi|222870739|gb|EEF07870.1| predicted protein [Populus trichocarpa] Length = 348 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = +2 Query: 188 SNPVKFEDVSEELQKILDADMDQAGPRRRAREAFKHIQLSIDHILFK 328 S PV+F ++ +EL+KI+DA+MD+ R+RAREAFK IQL IDHILFK Sbjct: 3 SRPVRFPEIDDELRKIIDANMDEVPARKRAREAFKDIQLGIDHILFK 49