BLASTX nr result
ID: Salvia21_contig00031612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00031612 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63563.1| hypothetical protein VITISV_003097 [Vitis vinifera] 58 9e-07 emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera] 57 1e-06 emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera] 55 8e-06 >emb|CAN63563.1| hypothetical protein VITISV_003097 [Vitis vinifera] Length = 1052 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 11 WCSKKQDAVSLSTTEAEYKASALASQECVWLQWLADELH 127 WCSK+Q VSLSTTEAEY+A+A+A+QE WL L ++LH Sbjct: 921 WCSKRQPTVSLSTTEAEYRAAAMATQESTWLIXLMNDLH 959 >emb|CAN71427.1| hypothetical protein VITISV_027864 [Vitis vinifera] Length = 1300 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 11 WCSKKQDAVSLSTTEAEYKASALASQECVWLQWLADELH 127 WCSK+Q VSLSTTEAEY+A+A+A+QE +WL L ++LH Sbjct: 1169 WCSKRQPTVSLSTTEAEYRAAAMATQESMWLIRLMNDLH 1207 >emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera] Length = 973 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +2 Query: 11 WCSKKQDAVSLSTTEAEYKASALASQECVWLQWLADELH 127 WCSK+Q VSL TTEAEY+A+A+A+QE WL L ++LH Sbjct: 842 WCSKRQPTVSLLTTEAEYRAAAMAAQESTWLIRLMNDLH 880