BLASTX nr result
ID: Salvia21_contig00030081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00030081 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35877.3| unnamed protein product [Vitis vinifera] 60 1e-07 emb|CAN74895.1| hypothetical protein VITISV_029985 [Vitis vinifera] 60 1e-07 ref|XP_003627266.1| AP2-like ethylene-responsive transcription f... 54 1e-05 >emb|CBI35877.3| unnamed protein product [Vitis vinifera] Length = 542 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/64 (43%), Positives = 40/64 (62%) Frame = -1 Query: 194 WRYDNEMNESNPNEEGGPKFEDFLGNCYSNSPQNEPGEINMNMPPNFDDQKREDFNNPPL 15 WRY+N+M ++P+ E PK EDFLG CYSNS + +N+N PP+F+ + + PP Sbjct: 56 WRYENDMGGTDPSGEA-PKLEDFLGCCYSNSSDD---RVNVNAPPSFNSNGELEADPPPQ 111 Query: 14 FYPY 3 PY Sbjct: 112 IQPY 115 >emb|CAN74895.1| hypothetical protein VITISV_029985 [Vitis vinifera] Length = 565 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/64 (43%), Positives = 40/64 (62%) Frame = -1 Query: 194 WRYDNEMNESNPNEEGGPKFEDFLGNCYSNSPQNEPGEINMNMPPNFDDQKREDFNNPPL 15 WRY+N+M ++P+ E PK EDFLG CYSNS + +N+N PP+F+ + + PP Sbjct: 56 WRYENDMGGTDPSGEA-PKLEDFLGCCYSNSSDD---RVNVNAPPSFNSNGELEADPPPQ 111 Query: 14 FYPY 3 PY Sbjct: 112 IQPY 115 >ref|XP_003627266.1| AP2-like ethylene-responsive transcription factor ANT [Medicago truncatula] gi|355521288|gb|AET01742.1| AP2-like ethylene-responsive transcription factor ANT [Medicago truncatula] Length = 574 Score = 54.3 bits (129), Expect = 1e-05 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 11/75 (14%) Frame = -1 Query: 194 WRYDNEMNESNPNEEGGPKFEDFLGNCYSNSPQNEP-----GEINMNMPPNF------DD 48 WRY+N + + N NEE GPK EDFLG CYSN QN +IN+N+ P+F + Sbjct: 75 WRYENAITDGNSNEE-GPKLEDFLG-CYSNQNQNSTTTSTMSKINVNVSPSFCTNNNPEI 132 Query: 47 QKREDFNNPPLFYPY 3 RE+ N L + + Sbjct: 133 DTRENLTNQSLIHSF 147