BLASTX nr result
ID: Salvia21_contig00029558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00029558 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutesce... 57 1e-06 emb|CAC83059.2| putative terpenesynthase-1 [Marrubium vulgare] 57 2e-06 gb|AAX16077.1| valencene synthase [Perilla frutescens var. frute... 55 6e-06 >gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutescens var. frutescens] Length = 550 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 3 VTYKGNEDGYTQPEKVLKPHIIALFVDPIKM 95 V YK ++DGYTQPEKVLKPHIIALFVDPI++ Sbjct: 520 VAYKDSQDGYTQPEKVLKPHIIALFVDPIQI 550 >emb|CAC83059.2| putative terpenesynthase-1 [Marrubium vulgare] Length = 545 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 3 VTYKGNEDGYTQPEKVLKPHIIALFVDPI 89 VTYK EDGYTQPEKVLKPHIIALFVD I Sbjct: 515 VTYKNKEDGYTQPEKVLKPHIIALFVDQI 543 >gb|AAX16077.1| valencene synthase [Perilla frutescens var. frutescens] Length = 550 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 3 VTYKGNEDGYTQPEKVLKPHIIALFVDPI 89 VTYKGN+D YTQPEKVLKPHII F DPI Sbjct: 520 VTYKGNQDRYTQPEKVLKPHIIVFFFDPI 548