BLASTX nr result
ID: Salvia21_contig00029290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00029290 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containi... 82 4e-14 ref|XP_002882884.1| predicted protein [Arabidopsis lyrata subsp.... 80 1e-13 ref|XP_002521673.1| pentatricopeptide repeat-containing protein,... 77 1e-12 ref|NP_188076.1| pentatricopeptide repeat-containing protein [Ar... 77 2e-12 emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] 72 4e-11 >ref|XP_004146072.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] gi|449503658|ref|XP_004162112.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Cucumis sativus] Length = 411 Score = 82.0 bits (201), Expect = 4e-14 Identities = 37/78 (47%), Positives = 50/78 (64%) Frame = +3 Query: 3 NPGTYQEVLYCLLDSNKYSEAXXXXXXXXXXXINPSFQSYKLVIQGFCGEKGVEDVEWAL 182 N GTYQEVLY LLD+ K+ EA ++PSF SYK ++ G C +K EDV+W L Sbjct: 302 NAGTYQEVLYGLLDTGKFIEARDCMHRMISEGMDPSFVSYKKLLSGLCKKKLTEDVDWVL 361 Query: 183 RHMLAHGFLPKMGMWNTM 236 + M+ GF+PK+GMW + Sbjct: 362 KQMVMQGFVPKVGMWKVI 379 >ref|XP_002882884.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328724|gb|EFH59143.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 409 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/75 (49%), Positives = 46/75 (61%) Frame = +3 Query: 3 NPGTYQEVLYCLLDSNKYSEAXXXXXXXXXXXINPSFQSYKLVIQGFCGEKGVEDVEWAL 182 NPGTYQEVLY LLD + EA + PSF SYK ++ G C K V +++W L Sbjct: 306 NPGTYQEVLYGLLDKKRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVAEMDWVL 365 Query: 183 RHMLAHGFLPKMGMW 227 R M+ HGF+PK GMW Sbjct: 366 RKMVNHGFVPKTGMW 380 >ref|XP_002521673.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539064|gb|EEF40660.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 341 Score = 77.4 bits (189), Expect = 1e-12 Identities = 38/75 (50%), Positives = 47/75 (62%) Frame = +3 Query: 3 NPGTYQEVLYCLLDSNKYSEAXXXXXXXXXXXINPSFQSYKLVIQGFCGEKGVEDVEWAL 182 N G+YQEVLY LLD+ K+SEA PSF SYK +I G C EK + +V+ L Sbjct: 242 NAGSYQEVLYGLLDAGKFSEAKDFMDRMVCEGNGPSFVSYKKLIDGLCKEKLIGEVDCVL 301 Query: 183 RHMLAHGFLPKMGMW 227 + ML GF+PKMGMW Sbjct: 302 KQMLKQGFVPKMGMW 316 >ref|NP_188076.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274210|sp|Q9LUD6.1|PP230_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g14580, mitochondrial; Flags: Precursor gi|9294380|dbj|BAB02390.1| unnamed protein product [Arabidopsis thaliana] gi|119935972|gb|ABM06049.1| At3g14580 [Arabidopsis thaliana] gi|332642020|gb|AEE75541.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 405 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/75 (48%), Positives = 45/75 (60%) Frame = +3 Query: 3 NPGTYQEVLYCLLDSNKYSEAXXXXXXXXXXXINPSFQSYKLVIQGFCGEKGVEDVEWAL 182 NPGTYQEVLY LLD + EA + PSF SYK ++ G C K V +++W L Sbjct: 306 NPGTYQEVLYGLLDKKRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVVEMDWVL 365 Query: 183 RHMLAHGFLPKMGMW 227 R M+ HGF+PK MW Sbjct: 366 RQMVNHGFVPKTLMW 380 >emb|CAN60667.1| hypothetical protein VITISV_028261 [Vitis vinifera] Length = 393 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/75 (44%), Positives = 46/75 (61%) Frame = +3 Query: 3 NPGTYQEVLYCLLDSNKYSEAXXXXXXXXXXXINPSFQSYKLVIQGFCGEKGVEDVEWAL 182 N G+YQEVLY +LD+ ++ +A ++PSF SYK+VI G C E V DV W L Sbjct: 296 NAGSYQEVLYGVLDTGRFGKAKEFMCQMIDEGVSPSFVSYKMVIYGLCKENLVADVVWIL 355 Query: 183 RHMLAHGFLPKMGMW 227 + M+ GF+P+ MW Sbjct: 356 KQMVEQGFVPERWMW 370