BLASTX nr result
ID: Salvia21_contig00029127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00029127 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510636.1| Phosphoprotein ECPP44, putative [Ricinus com... 60 2e-07 gb|ACB41781.1| dehydrin [Rhododendron catawbiense] 59 5e-07 gb|AEQ19904.1| dehydrin 2 [Vitis yeshanensis] gi|384979223|gb|AF... 58 7e-07 ref|XP_002285919.1| PREDICTED: phosphoprotein ECPP44-like [Vitis... 58 7e-07 emb|CAN66038.1| hypothetical protein VITISV_010455 [Vitis vinifera] 58 7e-07 >ref|XP_002510636.1| Phosphoprotein ECPP44, putative [Ricinus communis] gi|223551337|gb|EEF52823.1| Phosphoprotein ECPP44, putative [Ricinus communis] Length = 230 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 Query: 264 AGTEQPEEKKGFLDKVKEKLPGQHKKGDEESQTAPPP 374 A T QPEEKKG L+K+KEKLPGQHKK DE + PPP Sbjct: 146 ASTPQPEEKKGLLEKIKEKLPGQHKKADEATPHPPPP 182 >gb|ACB41781.1| dehydrin [Rhododendron catawbiense] Length = 240 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 276 QPEEKKGFLDKVKEKLPGQHKKGDEESQTAPPP 374 QPEEKKGFLDK+KEKLPGQHKK +E + PPP Sbjct: 149 QPEEKKGFLDKIKEKLPGQHKKTEEAAVAPPPP 181 >gb|AEQ19904.1| dehydrin 2 [Vitis yeshanensis] gi|384979223|gb|AFI38956.1| dehydrin 2 [Vitis yeshanensis] Length = 205 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 276 QPEEKKGFLDKVKEKLPGQHKKGDEESQTAPPP 374 QPEEKKGFLDK+KEKLPGQHKK +E PPP Sbjct: 126 QPEEKKGFLDKIKEKLPGQHKKAEEVPPPPPPP 158 >ref|XP_002285919.1| PREDICTED: phosphoprotein ECPP44-like [Vitis vinifera] Length = 206 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 276 QPEEKKGFLDKVKEKLPGQHKKGDEESQTAPPP 374 QPEEKKGFLDK+KEKLPGQHKK +E PPP Sbjct: 127 QPEEKKGFLDKIKEKLPGQHKKAEEVPPPPPPP 159 >emb|CAN66038.1| hypothetical protein VITISV_010455 [Vitis vinifera] Length = 207 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 276 QPEEKKGFLDKVKEKLPGQHKKGDEESQTAPPP 374 QPEEKKGFLDK+KEKLPGQHKK +E PPP Sbjct: 128 QPEEKKGFLDKIKEKLPGQHKKAEEVPPPPPPP 160