BLASTX nr result
ID: Salvia21_contig00029023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00029023 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/66 (39%), Positives = 42/66 (63%) Frame = +1 Query: 1 LLLATGKYDMSSIVTCPSVLGCSIEKRLEPRLQILRLLESRNLIAKWPSLSTVTSFTDDL 180 LLL G D+S IV P +L CS+ +RL+PRL +L++LE++ L+ K PS ++ + Sbjct: 298 LLLNVGNLDISYIVRHPDLLICSVNQRLKPRLAVLQVLENKKLLQKKPSFTSFFKISGSQ 357 Query: 181 FFDKFI 198 F K++ Sbjct: 358 FLHKYV 363