BLASTX nr result
ID: Salvia21_contig00027933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00027933 (566 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516081.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_003542102.1| PREDICTED: uncharacterized protein LOC100792... 58 9e-07 >ref|XP_002516081.1| conserved hypothetical protein [Ricinus communis] gi|223544986|gb|EEF46501.1| conserved hypothetical protein [Ricinus communis] Length = 123 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -1 Query: 461 ELCWPRSFSTRNYERFEPCSSSIDGARS---SVRAAPIWRVVWKRIKREKKRVFAPSSNS 291 + C+ +S + Y+R + + + G S + A P WR++W++I +EKK++F SS+S Sbjct: 16 DACYVKS---QRYDRIDVSFNMLVGHESKTANTAATPRWRLLWRKIMKEKKKLFDCSSSS 72 Query: 290 SAVKLNYDPSSYSQNFDDQASMWAD 216 + +YDP +Y+QNFD +SMW+D Sbjct: 73 DRMHFSYDPYTYAQNFDQGSSMWSD 97 >ref|XP_003542102.1| PREDICTED: uncharacterized protein LOC100792375 [Glycine max] Length = 277 Score = 58.2 bits (139), Expect = 9e-07 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -1 Query: 362 PIWRVVWKRIKREKKRVFAPSSNSSAVKLNYDPSSYSQNFDDQASMWADD 213 P WR+ W++IKREK R+F SS+ + + + YDPSSYSQNFDD S+ D+ Sbjct: 203 PSWRMFWRKIKREKTRLF--SSSPAVLHVQYDPSSYSQNFDDGYSIDPDN 250