BLASTX nr result
ID: Salvia21_contig00027628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00027628 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 72 5e-11 emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] 69 4e-10 ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Vitis vinifera] Length = 882 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = +2 Query: 2 FDEMPERDIASWNTVISCVVKEGLYGEAFELFYDMLVEMQEGCRADYFTLSSLLIA 169 FDEMP RDIASWNTVIS VVKE +Y AFELF DM +G R D+FTLS++L+A Sbjct: 229 FDEMPHRDIASWNTVISSVVKEMMYERAFELFRDM--RRIDGFRIDHFTLSTILVA 282 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = +2 Query: 2 FDEMPERDIASWNTVISCVVKEGLYGEAFELFYDMLVEMQEGCRADYFTLSSLLIA 169 FDEMP RDIASWNTVIS VVKE +Y AFELF DM +G R D+FTLS++L+A Sbjct: 247 FDEMPHRDIASWNTVISSVVKEMMYERAFELFRDM--RRIDGFRIDHFTLSTILVA 300 >emb|CAN82063.1| hypothetical protein VITISV_016431 [Vitis vinifera] Length = 755 Score = 68.9 bits (167), Expect = 4e-10 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +2 Query: 2 FDEMPERDIASWNTVISCVVKEGLYGEAFELFYDMLVEMQEGCRADYFTLSSLLIA 169 FDEM RDIASWNTVIS VVKE +Y AFELF DM +G R D+FTLS++L+A Sbjct: 231 FDEMXHRDIASWNTVISSVVKEMMYERAFELFRDM--RRIDGFRIDHFTLSTILVA 284 >ref|XP_004156326.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +2 Query: 2 FDEMPERDIASWNTVISCVVKEGLYGEAFELFYDMLVEMQEGCRADYFTLSSLLIACA 175 F+EMPERDI SWNTVIS +VKE Y EAF+ F M ++ +G + D+F+LS+LL ACA Sbjct: 254 FEEMPERDITSWNTVISSLVKEFKYDEAFDYFRGM--QLCKGLKVDHFSLSTLLTACA 309 >ref|XP_004143370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Cucumis sativus] Length = 908 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +2 Query: 2 FDEMPERDIASWNTVISCVVKEGLYGEAFELFYDMLVEMQEGCRADYFTLSSLLIACA 175 F+EMPERDI SWNTVIS +VKE Y EAF+ F M ++ +G + D+F+LS+LL ACA Sbjct: 254 FEEMPERDITSWNTVISSLVKEFKYDEAFDYFRGM--QLCKGLKVDHFSLSTLLTACA 309