BLASTX nr result
ID: Salvia21_contig00027560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00027560 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containi... 152 3e-35 ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 ref|XP_002525148.1| pentatricopeptide repeat-containing protein,... 122 3e-26 ref|NP_563765.1| pentatricopeptide repeat-containing protein [Ar... 114 7e-24 ref|XP_002330712.1| predicted protein [Populus trichocarpa] gi|2... 114 1e-23 >ref|XP_002278909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270 [Vitis vinifera] gi|302143379|emb|CBI21940.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 152 bits (384), Expect = 3e-35 Identities = 76/128 (59%), Positives = 98/128 (76%) Frame = +1 Query: 157 LEESIRAAVEAKAYQKIPQILNAAIDSCRNPNPFTFLSKFSESRRFEIIDEMLQSFISIR 336 LEESI+AAVE+K YQKIP +L + ++C NPNPF+FLS FS++ R +++DE+LQSFI +R Sbjct: 34 LEESIKAAVESKTYQKIPDLLISLEETCLNPNPFSFLSTFSQNLRTQVVDEILQSFIPLR 93 Query: 337 PRSQPRRAYSCLLSLTLDTSINHLPLALAVVQRTLRSGCLPPPQIHLLLAKSWLDXXXXX 516 PRS+P+ AY+CLLS TL S N LPLALA++QRTLRSGC+P PQ HLLL+ +WL Sbjct: 94 PRSRPQIAYACLLSFTLQ-SANPLPLALAILQRTLRSGCIPVPQTHLLLSSAWLSRRRQS 152 Query: 517 XXXXXILS 540 ILS Sbjct: 153 HSVSNILS 160 >ref|XP_003540386.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06270-like [Glycine max] Length = 342 Score = 130 bits (326), Expect = 2e-28 Identities = 67/116 (57%), Positives = 90/116 (77%) Frame = +1 Query: 154 NLEESIRAAVEAKAYQKIPQILNAAIDSCRNPNPFTFLSKFSESRRFEIIDEMLQSFISI 333 NLE+++RA VEAK Y KIP++L ++ D+C+ NPF+F S F ++ R +I+DEMLQS I I Sbjct: 33 NLEQAVRAEVEAKNYIKIPELLISS-DACQISNPFSFFSSFPQNIRVQIVDEMLQSLIPI 91 Query: 334 RPRSQPRRAYSCLLSLTLDTSINHLPLALAVVQRTLRSGCLPPPQIHLLLAKSWLD 501 RPRS+ + YS LLS TL +S + PLALAV+QRTLRSGC+P PQ H+LL+ +WLD Sbjct: 92 RPRSKAQLTYSYLLSYTLQSS-HPFPLALAVLQRTLRSGCVPVPQTHVLLSSAWLD 146 >ref|XP_002525148.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535607|gb|EEF37275.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 354 Score = 122 bits (307), Expect = 3e-26 Identities = 65/117 (55%), Positives = 87/117 (74%), Gaps = 1/117 (0%) Frame = +1 Query: 154 NLEESIRAAVEAKAYQKIPQIL-NAAIDSCRNPNPFTFLSKFSESRRFEIIDEMLQSFIS 330 +LE SI+AA+E ++YQ+IP +L ++ I S NPNPF+FLS F ++R IID++LQSFI+ Sbjct: 43 SLERSIKAAIETESYQEIPDLLISSKIQSLHNPNPFSFLSTFPLNQRTHIIDKILQSFIT 102 Query: 331 IRPRSQPRRAYSCLLSLTLDTSINHLPLALAVVQRTLRSGCLPPPQIHLLLAKSWLD 501 IRP S+ + YSCLLS TL S N LPLALA++QR RSG +P PQI L L +WL+ Sbjct: 103 IRPHSRLKLVYSCLLSHTLQ-SPNPLPLALAILQRGFRSGFMPEPQIRLFLTSAWLN 158 >ref|NP_563765.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75264068|sp|Q9LNC0.1|PPR16_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g06270 gi|8844132|gb|AAF80224.1|AC025290_13 Contains similarity to an unknown protein F23N19.4 gi|6630464 from Arabidopsis thaliana gb|AC007190 and contains multiple PPR PF|01535 repeats. EST gb|T44174 comes from this gene [Arabidopsis thaliana] gi|17529194|gb|AAL38823.1| unknown protein [Arabidopsis thaliana] gi|20465473|gb|AAM20196.1| unknown protein [Arabidopsis thaliana] gi|21536601|gb|AAM60933.1| unknown [Arabidopsis thaliana] gi|332189849|gb|AEE27970.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 343 Score = 114 bits (286), Expect = 7e-24 Identities = 56/115 (48%), Positives = 82/115 (71%) Frame = +1 Query: 157 LEESIRAAVEAKAYQKIPQILNAAIDSCRNPNPFTFLSKFSESRRFEIIDEMLQSFISIR 336 +E++I+ AVE K Y +IP+++ + + +N F+FLS F R +IDE+LQSF+ +R Sbjct: 34 VEKAIKCAVETKEYLRIPELVVSLKEPYQNSTLFSFLSAFQRHHRIRVIDEILQSFVPVR 93 Query: 337 PRSQPRRAYSCLLSLTLDTSINHLPLALAVVQRTLRSGCLPPPQIHLLLAKSWLD 501 PRS P+ YS LL+ L +S + LPL+ A++QRTLRSGCLP PQ HLLL+ +WL+ Sbjct: 94 PRSLPKIVYSSLLTYCLQSS-DPLPLSFAILQRTLRSGCLPNPQTHLLLSDAWLE 147 >ref|XP_002330712.1| predicted protein [Populus trichocarpa] gi|222872316|gb|EEF09447.1| predicted protein [Populus trichocarpa] Length = 341 Score = 114 bits (285), Expect = 1e-23 Identities = 59/115 (51%), Positives = 80/115 (69%) Frame = +1 Query: 157 LEESIRAAVEAKAYQKIPQILNAAIDSCRNPNPFTFLSKFSESRRFEIIDEMLQSFISIR 336 LEE+++AAVE K+Y K P + ++ S NP+PF+FLS F + R ++IDE++QS I IR Sbjct: 32 LEETLKAAVECKSYSKFPDLFDSFKQSNNNPSPFSFLSTFPFNLRTQVIDEIIQSLIPIR 91 Query: 337 PRSQPRRAYSCLLSLTLDTSINHLPLALAVVQRTLRSGCLPPPQIHLLLAKSWLD 501 PR + YS LLS TL S N L+LA++Q TLRSGCLP PQ H+ L+ +WLD Sbjct: 92 PRFRNFIVYSSLLSYTLQNS-NLFSLSLAIIQCTLRSGCLPVPQTHVSLSSAWLD 145