BLASTX nr result
ID: Salvia21_contig00026906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026906 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163684.1| PREDICTED: vacuolar protein sorting-associat... 61 8e-08 ref|XP_004147294.1| PREDICTED: vacuolar protein sorting-associat... 61 8e-08 gb|AFK35786.1| unknown [Medicago truncatula] 61 8e-08 ref|XP_003527138.1| PREDICTED: vacuolar protein sorting-associat... 61 8e-08 emb|CBI17151.3| unnamed protein product [Vitis vinifera] 61 8e-08 >ref|XP_004163684.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Cucumis sativus] Length = 228 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 132 MEKVMNILKPKPNPXXXXXXXXXXXXQECRNMERQIRDIQREEK 1 MEKVMNILKPKPNP QECRN+ERQIRDIQREEK Sbjct: 1 MEKVMNILKPKPNPQQQLRDWQRRLRQECRNVERQIRDIQREEK 44 >ref|XP_004147294.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Cucumis sativus] Length = 228 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 132 MEKVMNILKPKPNPXXXXXXXXXXXXQECRNMERQIRDIQREEK 1 MEKVMNILKPKPNP QECRN+ERQIRDIQREEK Sbjct: 1 MEKVMNILKPKPNPQQQLRDWQRRLRQECRNVERQIRDIQREEK 44 >gb|AFK35786.1| unknown [Medicago truncatula] Length = 227 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 132 MEKVMNILKPKPNPXXXXXXXXXXXXQECRNMERQIRDIQREEK 1 MEKVMNILKPKPNP QECRN+ERQIRDIQREEK Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEK 44 >ref|XP_003527138.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Glycine max] Length = 227 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 132 MEKVMNILKPKPNPXXXXXXXXXXXXQECRNMERQIRDIQREEK 1 MEKVMNILKPKPNP QECRN+ERQIRDIQREEK Sbjct: 1 MEKVMNILKPKPNPQQLLRDWQRRLRQECRNIERQIRDIQREEK 44 >emb|CBI17151.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = -1 Query: 132 MEKVMNILKPKPNPXXXXXXXXXXXXQECRNMERQIRDIQREEK 1 MEKVMNILKPKPNP QECRN+ERQIRDIQREEK Sbjct: 32 MEKVMNILKPKPNPQQQLRDWQRKLRQECRNIERQIRDIQREEK 75