BLASTX nr result
ID: Salvia21_contig00026829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026829 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303987.1| predicted protein [Populus trichocarpa] gi|2... 52 2e-08 ref|XP_002297620.1| predicted protein [Populus trichocarpa] gi|2... 51 1e-07 ref|XP_002523417.1| conserved hypothetical protein [Ricinus comm... 47 3e-06 >ref|XP_002303987.1| predicted protein [Populus trichocarpa] gi|222841419|gb|EEE78966.1| predicted protein [Populus trichocarpa] Length = 113 Score = 52.0 bits (123), Expect(2) = 2e-08 Identities = 22/45 (48%), Positives = 37/45 (82%), Gaps = 2/45 (4%) Frame = +1 Query: 16 MPFNSVLLISTATRSAELWQRLAC--LPERISSDEMVDLVICFPL 144 M FNS++++S A +SA++WQ++AC L +++SS +++DLV CFPL Sbjct: 1 MVFNSLIVLSVAHKSADVWQQIACMGLQDQVSSHQLLDLVCCFPL 45 Score = 31.2 bits (69), Expect(2) = 2e-08 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 240 GRWALYVWTFLCVSP 284 GR++LY+WTFLC+ P Sbjct: 49 GRFSLYIWTFLCLPP 63 >ref|XP_002297620.1| predicted protein [Populus trichocarpa] gi|222844878|gb|EEE82425.1| predicted protein [Populus trichocarpa] Length = 110 Score = 50.8 bits (120), Expect(2) = 1e-07 Identities = 22/45 (48%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +1 Query: 16 MPFNSVLLISTATRSAELWQRLACL--PERISSDEMVDLVICFPL 144 M FNS++++S A SA++WQ++AC+ +R+SS +++DLV CFPL Sbjct: 1 MVFNSLIVLSVAHVSADVWQQIACIRFQDRVSSHQLLDLVCCFPL 45 Score = 30.0 bits (66), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 240 GRWALYVWTFLCVSP 284 GR AL+VWTFLC+ P Sbjct: 49 GRLALFVWTFLCLPP 63 >ref|XP_002523417.1| conserved hypothetical protein [Ricinus communis] gi|223537367|gb|EEF38996.1| conserved hypothetical protein [Ricinus communis] Length = 138 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 22/45 (48%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 16 MPFNSVLLISTATRSAELWQRLACL--PERISSDEMVDLVICFPL 144 M FNS+++ S A SA+LWQ +A + +RISS +++DL+ CFPL Sbjct: 1 MVFNSLIIASVAHTSADLWQEIARIQVQDRISSHQLLDLICCFPL 45 Score = 28.9 bits (63), Expect(2) = 3e-06 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 4/25 (16%) Frame = +3 Query: 240 GRWALYVWTFLCVSP----YPHRHH 302 G +AL++WTFLC+ P YP+ ++ Sbjct: 49 GSFALWLWTFLCLPPPDSFYPYTYY 73