BLASTX nr result
ID: Salvia21_contig00026769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026769 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 55 1e-08 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 61 4e-08 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 59 5e-07 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 55.1 bits (131), Expect(2) = 1e-08 Identities = 33/73 (45%), Positives = 35/73 (47%) Frame = +2 Query: 59 SGGHLLQRKHHCSPPPEKQKIRESRLKIHA*IVV*CQGRRRKLGTEPYEAEVSRTVL*EG 238 +GGHL QRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES------------------------------------ 317 Query: 239 SGYLLELRPTTTG 277 SGYLLELRPTTTG Sbjct: 318 SGYLLELRPTTTG 330 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 27 PLVRLASERFFRA 65 PLVRLASERFFRA Sbjct: 275 PLVRLASERFFRA 287 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 60.8 bits (146), Expect(2) = 4e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 150 YACIFSLDSRIFCFSGGGEQWCLRCSRCPP 61 YAC+F LDSRIFCFSGGGEQ LRC RCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 21.2 bits (43), Expect(2) = 4e-08 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 169 LALDHYLCMY 140 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/53 (62%), Positives = 33/53 (62%), Gaps = 9/53 (16%) Frame = -1 Query: 132 LDSRIFCFSGGGEQWCLRCSRCP-------PERTAH*LAG--LGGPIWRHTEN 1 LDSRIFCFSGGGEQ LRC RCP P R LA GGPI RHTEN Sbjct: 52 LDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPARKNRSLASRTSGGPIRRHTEN 104