BLASTX nr result
ID: Salvia21_contig00026742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026742 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 72 6e-11 ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 72 6e-11 ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_63... 72 6e-11 ref|YP_538893.1| Ycf2 [Solanum bulbocastanum] gi|91209052|ref|YP... 72 6e-11 gb|ABB90081.1| Ycf2 [Solanum tuberosum] gi|82754685|gb|ABB90099.... 72 6e-11 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 EESVGSFDINMLIVPLLYLPKRKKIYESCFLNPKESTWVLP 123 EESVGS +IN LIV LLYLPK KKI ESCFLNPKESTWVLP Sbjct: 124 EESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVLP 164 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 EESVGSFDINMLIVPLLYLPKRKKIYESCFLNPKESTWVLP 123 EESVGS +IN LIV LLYLPK KKI ESCFLNPKESTWVLP Sbjct: 124 EESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVLP 164 >ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_635701.1| Ycf2 [Solanum tuberosum] gi|109896306|sp|Q27RY7.1|YCF2_SOLTU RecName: Full=Protein ycf2 gi|88656846|gb|ABD47099.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|88656866|gb|ABD47119.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|329124625|gb|AEB72182.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124644|gb|AEB72201.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124712|gb|AEB72268.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124731|gb|AEB72287.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] Length = 2278 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 EESVGSFDINMLIVPLLYLPKRKKIYESCFLNPKESTWVLP 123 EESVGS +IN LIV LLYLPK KKI ESCFLNPKESTWVLP Sbjct: 124 EESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVLP 164 >ref|YP_538893.1| Ycf2 [Solanum bulbocastanum] gi|91209052|ref|YP_538912.1| Ycf2 [Solanum bulbocastanum] gi|109896305|sp|Q2MIC5.1|YCF2_SOLBU RecName: Full=Protein ycf2 gi|84371938|gb|ABC56256.1| hypothetical chloroplast RF2 [Solanum bulbocastanum] gi|84371959|gb|ABC56277.1| hypothetical chloroplast RF2 [Solanum bulbocastanum] Length = 2278 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 EESVGSFDINMLIVPLLYLPKRKKIYESCFLNPKESTWVLP 123 EESVGS +IN LIV LLYLPK KKI ESCFLNPKESTWVLP Sbjct: 124 EESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVLP 164 >gb|ABB90081.1| Ycf2 [Solanum tuberosum] gi|82754685|gb|ABB90099.1| Ycf2 [Solanum tuberosum] Length = 2278 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 EESVGSFDINMLIVPLLYLPKRKKIYESCFLNPKESTWVLP 123 EESVGS +IN LIV LLYLPK KKI ESCFLNPKESTWVLP Sbjct: 124 EESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVLP 164