BLASTX nr result
ID: Salvia21_contig00026721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026721 (577 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510035.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_002510035.1| conserved hypothetical protein [Ricinus communis] gi|223550736|gb|EEF52222.1| conserved hypothetical protein [Ricinus communis] Length = 192 Score = 55.8 bits (133), Expect = 5e-06 Identities = 36/80 (45%), Positives = 47/80 (58%), Gaps = 6/80 (7%) Frame = -1 Query: 562 PIPYSDEAARFNNHASIRRLLMKLGGRFSSQDP----SSSNQYPEIGDQPMYSHPINDQI 395 P+PYS + RFN+HASIR+LL KLGGRFS D +SSN P+ ++ Y+ + DQ Sbjct: 33 PVPYSYQEPRFNDHASIRKLLTKLGGRFSDDDDLMIHNSSN--PQFPNEISYTPQLYDQT 90 Query: 394 --IASSDQTPPLSAAAPPHF 341 I+SS LS A F Sbjct: 91 TNISSSASMEALSNNASAQF 110