BLASTX nr result
ID: Salvia21_contig00026665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026665 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] 91 1e-16 ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum]... 91 1e-16 gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] 90 2e-16 dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] 90 2e-16 ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Popul... 89 4e-16 >emb|CAD29735.1| allene oxide synthase [Solanum tuberosum] Length = 530 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = -3 Query: 225 NKQCAGKDFVVLISRLLLVEFFLRYDSFDIEVAASPLGAAVTVTSLKRATF 73 NKQCAGKDFVVL+SRLLLVE FLRYDSF+IEV ASPLGAA+T+TSL+RA+F Sbjct: 480 NKQCAGKDFVVLVSRLLLVELFLRYDSFEIEVGASPLGAAITLTSLRRASF 530 >ref|NP_001234833.1| allene oxide synthase [Solanum lycopersicum] gi|7581989|emb|CAB88032.1| allene oxide synthase [Solanum lycopersicum] Length = 534 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/51 (84%), Positives = 49/51 (96%) Frame = -3 Query: 225 NKQCAGKDFVVLISRLLLVEFFLRYDSFDIEVAASPLGAAVTVTSLKRATF 73 NKQCAGKDFVVL+SRLLLVE FLRYDSF+IEV ASPLGAA+T+TSL+RA+F Sbjct: 484 NKQCAGKDFVVLVSRLLLVELFLRYDSFEIEVGASPLGAAITLTSLRRASF 534 >gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] Length = 376 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 225 NKQCAGKDFVVLISRLLLVEFFLRYDSFDIEVAASPLGAAVTVTSLKRATF 73 NKQCAGKDFVVL+SRL++VE FLRYDSFDIEV SPLGA+VTVTSLKRA+F Sbjct: 326 NKQCAGKDFVVLVSRLMVVELFLRYDSFDIEVGTSPLGASVTVTSLKRASF 376 >dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] Length = 519 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -3 Query: 225 NKQCAGKDFVVLISRLLLVEFFLRYDSFDIEVAASPLGAAVTVTSLKRATF 73 NKQCAGKDFVVL+SRL++VE FLRYDSFDIEV SPLGA+VTVTSLKRA+F Sbjct: 469 NKQCAGKDFVVLVSRLMVVELFLRYDSFDIEVGTSPLGASVTVTSLKRASF 519 >ref|XP_002302453.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] gi|222844179|gb|EEE81726.1| cytochrome P450 allene oxide synthase [Populus trichocarpa] Length = 526 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 225 NKQCAGKDFVVLISRLLLVEFFLRYDSFDIEVAASPLGAAVTVTSLKRATF 73 NKQCAGKDFVVL+SRL +VE FLRYDSF+IEV SPLGAAVTVTSLKRA+F Sbjct: 476 NKQCAGKDFVVLVSRLFVVELFLRYDSFEIEVGTSPLGAAVTVTSLKRASF 526