BLASTX nr result
ID: Salvia21_contig00026152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00026152 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136211.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_004136211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Cucumis sativus] gi|449508034|ref|XP_004163198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31920-like [Cucumis sativus] Length = 606 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 7/55 (12%) Frame = +2 Query: 197 IQHQNHAKIPETDHYSN-------QKEQECICMIKKCKNLEEFKQIHGQILKFGL 340 + + NH +P D + QKEQE +C++KKCK+LEEFKQ+H QILKFGL Sbjct: 6 VLNYNHHLLPSKDLPQSSSELNLKQKEQEYLCLVKKCKSLEEFKQVHVQILKFGL 60