BLASTX nr result
ID: Salvia21_contig00024222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00024222 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330652.1| predicted protein [Populus trichocarpa] gi|2... 145 4e-33 ref|XP_002273984.2| PREDICTED: C2 and GRAM domain-containing pro... 142 4e-32 ref|XP_002531896.1| conserved hypothetical protein [Ricinus comm... 142 4e-32 ref|XP_003528491.1| PREDICTED: C2 and GRAM domain-containing pro... 138 5e-31 ref|XP_003608069.1| GRAM domain-containing protein [Medicago tru... 132 3e-29 >ref|XP_002330652.1| predicted protein [Populus trichocarpa] gi|222872256|gb|EEF09387.1| predicted protein [Populus trichocarpa] Length = 590 Score = 145 bits (365), Expect = 4e-33 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 1/86 (1%) Frame = -1 Query: 255 IRVEHEGQTGAVWYTLDSPSGQVCLHIRTLKLQMNSSRVLNGYAGTNPRRR-PLDKQGPT 79 + VE EGQTGA WYTLDSPSGQVCLHI+T+K+ NS+R +NGYAG NPRRR DKQGPT Sbjct: 162 VPVESEGQTGAEWYTLDSPSGQVCLHIKTIKVPANSARAVNGYAGANPRRRISSDKQGPT 221 Query: 78 VVHQKPGPLQTIFNLLPDEVVEHSYS 1 VVHQKPGPLQTIF+LLPDEVVEHSYS Sbjct: 222 VVHQKPGPLQTIFSLLPDEVVEHSYS 247 >ref|XP_002273984.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|296084286|emb|CBI24674.3| unnamed protein product [Vitis vinifera] Length = 588 Score = 142 bits (357), Expect = 4e-32 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 1/86 (1%) Frame = -1 Query: 255 IRVEHEGQTGAVWYTLDSPSGQVCLHIRTLKLQMNSSRVLNGYAGTNPRRR-PLDKQGPT 79 + VE EGQTGAVWY+LDS SGQVCLHI+T+KL +NSSRVLNGY+G N RRR DKQGPT Sbjct: 161 VPVETEGQTGAVWYSLDSTSGQVCLHIKTIKLPVNSSRVLNGYSGANTRRRMSSDKQGPT 220 Query: 78 VVHQKPGPLQTIFNLLPDEVVEHSYS 1 +VHQKPGPLQTIFNL PDEVVEHSYS Sbjct: 221 LVHQKPGPLQTIFNLHPDEVVEHSYS 246 >ref|XP_002531896.1| conserved hypothetical protein [Ricinus communis] gi|223528463|gb|EEF30495.1| conserved hypothetical protein [Ricinus communis] Length = 532 Score = 142 bits (357), Expect = 4e-32 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 1/86 (1%) Frame = -1 Query: 255 IRVEHEGQTGAVWYTLDSPSGQVCLHIRTLKLQMNSSRVLNGYAGTNPRRR-PLDKQGPT 79 + VE EGQTGAVWYTLDSPSGQVCLHI+T+KL +NSSR +NGYAG + RRR LD QGPT Sbjct: 171 VPVESEGQTGAVWYTLDSPSGQVCLHIKTIKLSVNSSRAMNGYAGASARRRISLDTQGPT 230 Query: 78 VVHQKPGPLQTIFNLLPDEVVEHSYS 1 VVHQKPGPLQTIFNL DE+VEHSYS Sbjct: 231 VVHQKPGPLQTIFNLPADEIVEHSYS 256 >ref|XP_003528491.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 585 Score = 138 bits (347), Expect = 5e-31 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 2/87 (2%) Frame = -1 Query: 255 IRVEHEGQTGAVWYTLDSPSGQVCLHIRTLKLQMNSSRVLNGYAGTNPRRR--PLDKQGP 82 + VE EGQTGAVW+TLDSPSGQVCLHI+T+KL N+SR+ NGY G NPRRR PL+ QGP Sbjct: 159 VPVESEGQTGAVWHTLDSPSGQVCLHIKTIKLSGNASRI-NGYGGANPRRRMPPLESQGP 217 Query: 81 TVVHQKPGPLQTIFNLLPDEVVEHSYS 1 TVVHQKPGPLQTIF L PDEVV+HSYS Sbjct: 218 TVVHQKPGPLQTIFGLHPDEVVDHSYS 244 >ref|XP_003608069.1| GRAM domain-containing protein [Medicago truncatula] gi|355509124|gb|AES90266.1| GRAM domain-containing protein [Medicago truncatula] Length = 453 Score = 132 bits (332), Expect = 3e-29 Identities = 65/86 (75%), Positives = 73/86 (84%), Gaps = 1/86 (1%) Frame = -1 Query: 255 IRVEHEGQTGAVWYTLDSPSGQVCLHIRTLKLQMNSSRVLNGYAGTNPRRR-PLDKQGPT 79 + VE EGQTGAVW+TLDSPSGQVCLHI+T K+ NS+R+ NGY G N RRR PL+KQ PT Sbjct: 157 VPVESEGQTGAVWHTLDSPSGQVCLHIKTEKMSANSARI-NGYGGANTRRRIPLEKQEPT 215 Query: 78 VVHQKPGPLQTIFNLLPDEVVEHSYS 1 VVHQKPGPLQTIF L PDEVV+HSYS Sbjct: 216 VVHQKPGPLQTIFELHPDEVVDHSYS 241