BLASTX nr result
ID: Salvia21_contig00024157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00024157 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529479.1| Transcription factor RF2a, putative [Ricinus... 62 5e-08 >ref|XP_002529479.1| Transcription factor RF2a, putative [Ricinus communis] gi|223531037|gb|EEF32889.1| Transcription factor RF2a, putative [Ricinus communis] Length = 425 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -2 Query: 136 MDKDKSHHGNILPPSGRYAAFSPPGSSYNAKSEQAGLSSLPPLGP 2 MDKDK H G + PPSGR+++FSP GSS+N K E + ++LPP+ P Sbjct: 1 MDKDKGHSGGLPPPSGRFSSFSPTGSSFNVKPEPSSAAALPPIAP 45