BLASTX nr result
ID: Salvia21_contig00023990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023990 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301375.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|XP_002511924.1| Proline iminopeptidase, putative [Ricinus co... 79 3e-13 ref|XP_002320159.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 ref|XP_003534538.1| PREDICTED: proline iminopeptidase-like [Glyc... 77 1e-12 ref|XP_003624080.1| Proline iminopeptidase [Medicago truncatula]... 77 2e-12 >ref|XP_002301375.1| predicted protein [Populus trichocarpa] gi|222843101|gb|EEE80648.1| predicted protein [Populus trichocarpa] Length = 457 Score = 80.1 bits (196), Expect = 2e-13 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +2 Query: 164 ERVTSDWFSVPDLRLRNHRFTVPLDYSLSEPASPKISVFVREVVGVGKEE 313 + V W+SVPDLRLR+HRFTVPLDYS+ ASPKISVF REVV VGKEE Sbjct: 13 DHVAGTWYSVPDLRLRDHRFTVPLDYSIDRNASPKISVFAREVVSVGKEE 62 >ref|XP_002511924.1| Proline iminopeptidase, putative [Ricinus communis] gi|223549104|gb|EEF50593.1| Proline iminopeptidase, putative [Ricinus communis] Length = 513 Score = 79.3 bits (194), Expect = 3e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +2 Query: 164 ERVTSDWFSVPDLRLRNHRFTVPLDYSLSEPASPKISVFVREVVGVGKEE 313 + + W+SVPDLRLR+HRFTVPLDYS+ ASPKIS+F REVV VGKEE Sbjct: 63 QHIAGHWYSVPDLRLRDHRFTVPLDYSIDHNASPKISIFAREVVAVGKEE 112 >ref|XP_002320159.1| predicted protein [Populus trichocarpa] gi|222860932|gb|EEE98474.1| predicted protein [Populus trichocarpa] Length = 443 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +2 Query: 164 ERVTSDWFSVPDLRLRNHRFTVPLDYSLSEPASPKISVFVREVVGVGKEE 313 + ++ W+SVP LRLR+HRFTVPLDYS+ ASPKISVF REVV VGKEE Sbjct: 13 DHISGTWYSVPGLRLRDHRFTVPLDYSIDRNASPKISVFAREVVSVGKEE 62 >ref|XP_003534538.1| PREDICTED: proline iminopeptidase-like [Glycine max] Length = 464 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +2 Query: 164 ERVTSDWFSVPDLRLRNHRFTVPLDYSLSEPASPKISVFVREVVGVGKEE 313 + VT DW+SVP+LRLR+HRF VPLD+SL +SPKI+VF REVV VGKEE Sbjct: 14 DHVTKDWYSVPELRLRDHRFKVPLDHSLGPHSSPKITVFAREVVAVGKEE 63 >ref|XP_003624080.1| Proline iminopeptidase [Medicago truncatula] gi|355499095|gb|AES80298.1| Proline iminopeptidase [Medicago truncatula] Length = 517 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = +2 Query: 164 ERVTSDWFSVPDLRLRNHRFTVPLDYSLSEPASPKISVFVREVVGVGKEE 313 + VT DWFSVP LRLR+HRFTVPLDYS +S KI+VF REVV VGKEE Sbjct: 67 DHVTGDWFSVPSLRLRDHRFTVPLDYSQGPQSSSKITVFAREVVAVGKEE 116