BLASTX nr result
ID: Salvia21_contig00023891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023891 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 emb|CBI19144.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 59.7 bits (143), Expect = 2e-07 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -2 Query: 260 FFSTSKVERQIPNLKIYDVLVNKHHFSPESASLAASRSPK-SRCPKRADSVLSFFKENSF 84 FFSTS+ P + I+D L+N FSPESAS S + K + P+ AD VLSF E+ F Sbjct: 33 FFSTSRPSEIKPKVTIFDYLINHQQFSPESASNVLSSTTKYVKKPQNADLVLSFLTESGF 92 Query: 83 TTTQLEKIVIYYPPILGFRIE 21 + +E +V P +L + E Sbjct: 93 SKIHIENVVQKVPQVLSSKFE 113 >emb|CBI19144.3| unnamed protein product [Vitis vinifera] Length = 425 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 2/83 (2%) Frame = -2 Query: 260 FFSTSKVERQIPNLKIY--DVLVNKHHFSPESASLAASRSPKSRCPKRADSVLSFFKENS 87 FFS+S +++ P + + D L+ +H FS E+A AAS + P+++DS+L+F KE+ Sbjct: 34 FFSSSGPQKKKPAIPVSTADYLIKRHQFSQETALTAASVITYLKKPEKSDSILAFLKESG 93 Query: 86 FTTTQLEKIVIYYPPILGFRIER 18 F+ T LEK V P +L +++ Sbjct: 94 FSQTHLEKTVKRVPRVLSANLDK 116