BLASTX nr result
ID: Salvia21_contig00023883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023883 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] 44 5e-06 >emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] Length = 1361 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 20/50 (40%), Positives = 33/50 (66%) Frame = -1 Query: 418 SYSELDYDEEEGVWYVDSGATNHVTNTLANMQLNTPYNGSEALTVGNGQT 269 +YS D+++ E W+ DSGAT+H+T+ + Y+G+E + VGNGQ+ Sbjct: 422 AYSIQDFNDSE--WFPDSGATSHMTSDTEGVNQPDVYSGNERVMVGNGQS 469 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -2 Query: 291 LLLVMDKLNRKILLKGRLHQGLYQIDLSKLSPQSTASIPSAAV 163 LLL D++ R +L GR GLY +D + ST S P A+V Sbjct: 487 LLLSNDRVTRVVLGVGRCENGLYVLDRRHHALVSTTSSPRASV 529