BLASTX nr result
ID: Salvia21_contig00023856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023856 (580 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_678847.1| hypothetical protein [Plasmodium berghei strain... 58 1e-06 ref|XP_670041.1| hypothetical protein [Plasmodium berghei strain... 58 1e-06 ref|XP_668857.1| hypothetical protein [Plasmodium berghei strain... 57 3e-06 >ref|XP_678847.1| hypothetical protein [Plasmodium berghei strain ANKA] gi|56499443|emb|CAH97652.1| hypothetical protein PB105099.00.0 [Plasmodium berghei] Length = 69 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 486 RERLTLVPNSCSPGDPLVLERPPPRWSSSFC 578 R R + NSCSPGDPLVLERPPPRWSSSFC Sbjct: 37 RNREEIRSNSCSPGDPLVLERPPPRWSSSFC 67 >ref|XP_670041.1| hypothetical protein [Plasmodium berghei strain ANKA] gi|56484911|emb|CAH99654.1| hypothetical protein PB000410.03.0 [Plasmodium berghei] Length = 222 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 483 LRERLTLVPNSCSPGDPLVLERPPPRWSSSFC 578 +++ L+ NSCSPGDPLVLERPPPRWSSSFC Sbjct: 189 IKKLLSYKSNSCSPGDPLVLERPPPRWSSSFC 220 >ref|XP_668857.1| hypothetical protein [Plasmodium berghei strain ANKA] gi|56482330|emb|CAH95697.1| hypothetical protein PB102643.00.0 [Plasmodium berghei] Length = 154 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +3 Query: 510 NSCSPGDPLVLERPPPRWSSSFC 578 NSCSPGDPLVLERPPPRWSSSFC Sbjct: 130 NSCSPGDPLVLERPPPRWSSSFC 152