BLASTX nr result
ID: Salvia21_contig00023663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023663 (491 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517233.1| PREDICTED: cytochrome P450 90B1-like [Glycin... 126 2e-27 emb|CBI17531.3| unnamed protein product [Vitis vinifera] 126 2e-27 ref|XP_002267187.1| PREDICTED: cytochrome P450 90B1-like [Vitis ... 125 4e-27 ref|XP_003538851.1| PREDICTED: cytochrome P450 90B1-like [Glycin... 124 6e-27 ref|XP_002327809.1| predicted protein [Populus trichocarpa] gi|2... 120 9e-26 >ref|XP_003517233.1| PREDICTED: cytochrome P450 90B1-like [Glycine max] Length = 490 Score = 126 bits (317), Expect = 2e-27 Identities = 59/88 (67%), Positives = 70/88 (79%), Gaps = 6/88 (6%) Frame = -2 Query: 490 FNPWRWQ---SRGGRVSNET---NNLMAFGGGPRLCAGSELAKLEMAIFIHHLVLNFRFT 329 FNPWRWQ SRGG S++ NN + FGGGPRLCAGSELAKLEMA+FIHHL+LN+ + Sbjct: 402 FNPWRWQNNGSRGGSCSSKNTANNNFLPFGGGPRLCAGSELAKLEMAVFIHHLILNYHWE 461 Query: 328 LADSDQALAFPFVDFPKGLPVSVTRHHM 245 LAD+DQA A+PFVDFPKGLP+ V H + Sbjct: 462 LADTDQAFAYPFVDFPKGLPIRVQAHSL 489 >emb|CBI17531.3| unnamed protein product [Vitis vinifera] Length = 488 Score = 126 bits (316), Expect = 2e-27 Identities = 60/88 (68%), Positives = 65/88 (73%), Gaps = 7/88 (7%) Frame = -2 Query: 490 FNPWRWQSRGGRVSNETN-------NLMAFGGGPRLCAGSELAKLEMAIFIHHLVLNFRF 332 FNPWRWQ G N T+ N M FGGGPRLCAGSELAKLEMA+FIHHLVLN+ + Sbjct: 399 FNPWRWQQNNGNRGNSTSWSTATNQNFMPFGGGPRLCAGSELAKLEMAVFIHHLVLNYNW 458 Query: 331 TLADSDQALAFPFVDFPKGLPVSVTRHH 248 L D DQA AFPFVDFPKGLP+ V RHH Sbjct: 459 ELVDKDQAFAFPFVDFPKGLPIKV-RHH 485 >ref|XP_002267187.1| PREDICTED: cytochrome P450 90B1-like [Vitis vinifera] Length = 487 Score = 125 bits (314), Expect = 4e-27 Identities = 62/87 (71%), Positives = 67/87 (77%), Gaps = 6/87 (6%) Frame = -2 Query: 490 FNPWRWQSRGGRV-----SNETN-NLMAFGGGPRLCAGSELAKLEMAIFIHHLVLNFRFT 329 FNPWRWQ+ G R S TN N M FGGGPRLCAGSELAKLEMA+FIHHLVLN+ + Sbjct: 399 FNPWRWQNNGNRGNSTSWSTATNQNFMPFGGGPRLCAGSELAKLEMAVFIHHLVLNYNWE 458 Query: 328 LADSDQALAFPFVDFPKGLPVSVTRHH 248 L D DQA AFPFVDFPKGLP+ V RHH Sbjct: 459 LVDKDQAFAFPFVDFPKGLPIKV-RHH 484 >ref|XP_003538851.1| PREDICTED: cytochrome P450 90B1-like [Glycine max] Length = 489 Score = 124 bits (312), Expect = 6e-27 Identities = 57/87 (65%), Positives = 66/87 (75%), Gaps = 5/87 (5%) Frame = -2 Query: 490 FNPWRWQSRGGRVS-----NETNNLMAFGGGPRLCAGSELAKLEMAIFIHHLVLNFRFTL 326 FNPWRWQ+ G S NN + FGGGPRLCAGSELAKLEMA+FIHHL+LN+ + L Sbjct: 402 FNPWRWQNNGSHGSCPSKNTANNNFLPFGGGPRLCAGSELAKLEMAVFIHHLILNYHWEL 461 Query: 325 ADSDQALAFPFVDFPKGLPVSVTRHHM 245 AD+DQA A+PFVDFPKGLPV V H + Sbjct: 462 ADTDQAFAYPFVDFPKGLPVRVQAHSL 488 >ref|XP_002327809.1| predicted protein [Populus trichocarpa] gi|222836894|gb|EEE75287.1| predicted protein [Populus trichocarpa] Length = 488 Score = 120 bits (302), Expect = 9e-26 Identities = 57/88 (64%), Positives = 64/88 (72%), Gaps = 8/88 (9%) Frame = -2 Query: 490 FNPWRWQSRGGRVSN--------ETNNLMAFGGGPRLCAGSELAKLEMAIFIHHLVLNFR 335 FNPWRWQ R S+ +N+ M FGGGPRLCAGSELAKLEMA+FIHHLVLNF Sbjct: 398 FNPWRWQHNNARGSSTCSSAAAASSNHFMPFGGGPRLCAGSELAKLEMAVFIHHLVLNFH 457 Query: 334 FTLADSDQALAFPFVDFPKGLPVSVTRH 251 + L +DQA AFPFVDFPKGLP+ V H Sbjct: 458 WELVGADQAFAFPFVDFPKGLPIRVKHH 485