BLASTX nr result
ID: Salvia21_contig00023463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023463 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO23078.1| polyprotein [Glycine max] 56 3e-06 >gb|AAO23078.1| polyprotein [Glycine max] Length = 1552 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = -2 Query: 382 LPKELLSVDPPY*PERVLQHRMVVREDQAVDQVLVMWNVLNDDEATWLDLA-VHV*FPYF 206 LP + + P P ++L R+++R ++Q+LV W DEATW D+ + +P F Sbjct: 1430 LPLTVTEMGPVMQPVKILASRIIIRGHNQIEQILVQWENGLQDEATWEDIEDIKASYPTF 1489 Query: 205 SLEDNVVSAGEANDRDGLRPWIVYARGKK 119 +LED VV GE N +G+ +RG+K Sbjct: 1490 NLEDKVVFKGEGNVTNGM------SRGEK 1512