BLASTX nr result
ID: Salvia21_contig00023328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023328 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608575.1| hypothetical protein MTR_4g097730 [Medicago ... 57 2e-06 >ref|XP_003608575.1| hypothetical protein MTR_4g097730 [Medicago truncatula] gi|355509630|gb|AES90772.1| hypothetical protein MTR_4g097730 [Medicago truncatula] Length = 213 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 2/77 (2%) Frame = -1 Query: 412 WVGKHSVLPRKAKDHLEAFRNLG--EKEDTSFLNTIWLCFVWCVWKWRNVCKFQQEEWKA 239 W+ H V P+ DHL F LG K + S N IWL VW +W RN F Q+E Sbjct: 113 WLRFHIVFPKHVSDHLYQFGTLGGFSKSNRSAFNLIWLSCVWVIWIERNTRVFHQKEASF 172 Query: 238 ERVLAEIKTRTWGWASA 188 ++L +IK +++ W A Sbjct: 173 IQLLDKIKLQSYWWLKA 189