BLASTX nr result
ID: Salvia21_contig00023259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00023259 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28908.3| unnamed protein product [Vitis vinifera] 157 1e-36 ref|XP_002329409.1| predicted protein [Populus trichocarpa] gi|2... 155 2e-36 ref|XP_002532772.1| pentatricopeptide repeat-containing protein,... 153 1e-35 ref|NP_171855.1| pentatricopeptide repeat-containing protein [Ar... 149 2e-34 ref|XP_002892169.1| pentatricopeptide repeat-containing protein ... 149 2e-34 >emb|CBI28908.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 157 bits (396), Expect = 1e-36 Identities = 73/85 (85%), Positives = 82/85 (96%) Frame = -1 Query: 349 ARACKILDELAPMGVVLDTAFEDMINVLCKAGRVAEACRLADGVVDRGREIPGRVRTVMV 170 ARACKILDELAPMGV+ +TAFEDMINVLCKAGR +AC+LADG+VDRGRE+PGRVRT+++ Sbjct: 557 ARACKILDELAPMGVIPETAFEDMINVLCKAGRTEQACKLADGIVDRGREVPGRVRTILI 616 Query: 169 NALRKAGNADLAMKLMHSKIGIGYD 95 NALRKAGNADLAMKLMHSKIGIGYD Sbjct: 617 NALRKAGNADLAMKLMHSKIGIGYD 641 >ref|XP_002329409.1| predicted protein [Populus trichocarpa] gi|222870459|gb|EEF07590.1| predicted protein [Populus trichocarpa] Length = 599 Score = 155 bits (393), Expect = 2e-36 Identities = 73/85 (85%), Positives = 82/85 (96%) Frame = -1 Query: 349 ARACKILDELAPMGVVLDTAFEDMINVLCKAGRVAEACRLADGVVDRGREIPGRVRTVMV 170 ARACK+LDELAPMGV+ +TAFEDM+NVLCKAGR+ EAC+LADG VDRGREIPGRVRTV++ Sbjct: 499 ARACKLLDELAPMGVIPETAFEDMLNVLCKAGRIKEACKLADGFVDRGREIPGRVRTVLI 558 Query: 169 NALRKAGNADLAMKLMHSKIGIGYD 95 NALRKAGNADLA+KLMHSKIGIGYD Sbjct: 559 NALRKAGNADLALKLMHSKIGIGYD 583 >ref|XP_002532772.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527482|gb|EEF29611.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 647 Score = 153 bits (387), Expect = 1e-35 Identities = 71/85 (83%), Positives = 82/85 (96%) Frame = -1 Query: 349 ARACKILDELAPMGVVLDTAFEDMINVLCKAGRVAEACRLADGVVDRGREIPGRVRTVMV 170 ARACKILDE+APMGV+ +TAF+DMIN+LCKAGR+ EAC+LADG+VDRGREIPGRVRTV++ Sbjct: 546 ARACKILDEMAPMGVIPETAFDDMINILCKAGRIKEACKLADGIVDRGREIPGRVRTVLI 605 Query: 169 NALRKAGNADLAMKLMHSKIGIGYD 95 NALRKAGNADLA+KLM SKIGIGYD Sbjct: 606 NALRKAGNADLALKLMRSKIGIGYD 630 >ref|NP_171855.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180297|sp|Q9LR67.1|PPR9_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g03560, mitochondrial; Flags: Precursor gi|9280662|gb|AAF86531.1|AC002560_24 F21B7.18 [Arabidopsis thaliana] gi|332189465|gb|AEE27586.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 660 Score = 149 bits (377), Expect = 2e-34 Identities = 69/85 (81%), Positives = 78/85 (91%) Frame = -1 Query: 349 ARACKILDELAPMGVVLDTAFEDMINVLCKAGRVAEACRLADGVVDRGREIPGRVRTVMV 170 ARACKILDELAPMGV+LD A EDMIN LCKAGR+ EAC+LADG+ +RGRE+PGR+RTVM+ Sbjct: 555 ARACKILDELAPMGVILDAACEDMINTLCKAGRIKEACKLADGITERGREVPGRIRTVMI 614 Query: 169 NALRKAGNADLAMKLMHSKIGIGYD 95 NALRK G ADLAMKLMHSKIGIGY+ Sbjct: 615 NALRKVGKADLAMKLMHSKIGIGYE 639 >ref|XP_002892169.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338011|gb|EFH68428.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 662 Score = 149 bits (377), Expect = 2e-34 Identities = 69/85 (81%), Positives = 78/85 (91%) Frame = -1 Query: 349 ARACKILDELAPMGVVLDTAFEDMINVLCKAGRVAEACRLADGVVDRGREIPGRVRTVMV 170 ARACKILDELAPMGV+LD A EDMIN LCKAGR+ EAC+LADG+ +RGRE+PGR+RTVM+ Sbjct: 555 ARACKILDELAPMGVILDAACEDMINTLCKAGRIKEACKLADGITERGREVPGRIRTVMI 614 Query: 169 NALRKAGNADLAMKLMHSKIGIGYD 95 NALRK G ADLAMKLMHSKIGIGY+ Sbjct: 615 NALRKVGKADLAMKLMHSKIGIGYE 639