BLASTX nr result
ID: Salvia21_contig00022468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00022468 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314226.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 ref|XP_002513432.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002314226.1| predicted protein [Populus trichocarpa] gi|222850634|gb|EEE88181.1| predicted protein [Populus trichocarpa] Length = 422 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 2 PVEIDKARKVLKEHELALTDAITRFEDLSDGEKGT 106 P+EIDKA+KVLK+HE AL DAI+R D+SDGE GT Sbjct: 383 PLEIDKAKKVLKDHEQALVDAISRLADISDGESGT 417 >ref|XP_002513432.1| conserved hypothetical protein [Ricinus communis] gi|223547340|gb|EEF48835.1| conserved hypothetical protein [Ricinus communis] Length = 402 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 2 PVEIDKARKVLKEHELALTDAITRFEDLSDGEKGTN 109 P+EI+KA+KVL+EHE AL DAI R ED SDGE G N Sbjct: 367 PMEIEKAKKVLQEHEQALVDAIARLEDASDGESGNN 402