BLASTX nr result
ID: Salvia21_contig00022423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00022423 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF06706.1| UP-9A [Nicotiana tabacum] 55 6e-06 >gb|ABF06706.1| UP-9A [Nicotiana tabacum] Length = 117 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +3 Query: 249 CSQLGELEAEAVGQAREYRTRIMELLEQLSGAKKMLQ 359 CSQLGELEAEAV QAR YRTR++ L++QLS A+K+L+ Sbjct: 71 CSQLGELEAEAVDQARTYRTRVIHLMDQLSLAQKLLE 107