BLASTX nr result
ID: Salvia21_contig00022325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00022325 (564 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30928.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002519646.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 isoform 1... 64 2e-08 emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera] 64 2e-08 gb|AEX97082.1| F-box family protein [Malus x domestica] 63 3e-08 >emb|CBI30928.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 559 SEANWVASAFEEPFGTAARMLVKRRTYCLEMNSF 458 S+ +WV++AFEEP+GTAA+MLVKRRTYCLEMNSF Sbjct: 365 SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF 398 >ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis] gi|223541063|gb|EEF42619.1| conserved hypothetical protein [Ricinus communis] Length = 414 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 556 EANWVASAFEEPFGTAARMLVKRRTYCLEMNSF 458 +A+WV++AFEEP+GTAA+MLVKRRTYCLEMNSF Sbjct: 382 DASWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF 414 >ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 isoform 1 [Vitis vinifera] gi|359483890|ref|XP_003633032.1| PREDICTED: F-box protein At5g46170 isoform 2 [Vitis vinifera] Length = 399 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 559 SEANWVASAFEEPFGTAARMLVKRRTYCLEMNSF 458 S+ +WV++AFEEP+GTAA+MLVKRRTYCLEMNSF Sbjct: 366 SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF 399 >emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera] Length = 399 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 559 SEANWVASAFEEPFGTAARMLVKRRTYCLEMNSF 458 S+ +WV++AFEEP+GTAA+MLVKRRTYCLEMNSF Sbjct: 366 SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF 399 >gb|AEX97082.1| F-box family protein [Malus x domestica] Length = 403 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 559 SEANWVASAFEEPFGTAARMLVKRRTYCLEMNSF 458 S+ +W+++AFEEP+GTAA+MLVKRRTYCLEMNSF Sbjct: 370 SDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF 403