BLASTX nr result
ID: Salvia21_contig00022319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00022319 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517352.1| zinc finger protein, putative [Ricinus commu... 78 9e-13 ref|XP_003634293.1| PREDICTED: RING-H2 finger protein ATL48-like... 77 1e-12 ref|XP_003633831.1| PREDICTED: E3 ubiquitin-protein ligase ATL42... 77 1e-12 ref|XP_002438223.1| hypothetical protein SORBIDRAFT_10g009860 [S... 76 3e-12 ref|XP_004151031.1| PREDICTED: putative RING-H2 finger protein A... 75 7e-12 >ref|XP_002517352.1| zinc finger protein, putative [Ricinus communis] gi|223543363|gb|EEF44894.1| zinc finger protein, putative [Ricinus communis] Length = 200 Score = 77.8 bits (190), Expect = 9e-13 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 1 DCAICLDSFREGDNCRKIPICKHLFHSNCVDRWIGRKPNCPVCR 132 DCA+CLD+FR GD CR +PICKH FH+ CVD W+ + P CP+CR Sbjct: 75 DCAVCLDNFRAGDKCRLLPICKHSFHAQCVDEWLLKTPICPICR 118 >ref|XP_003634293.1| PREDICTED: RING-H2 finger protein ATL48-like [Vitis vinifera] Length = 146 Score = 77.4 bits (189), Expect = 1e-12 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 1 DCAICLDSFREGDNCRKIPICKHLFHSNCVDRWIGRKPNCPVCRT 135 DCA+CL++FR+GD CR +P CKH FHS C+D W+ + P CP+CRT Sbjct: 76 DCAVCLENFRKGDKCRLLPNCKHFFHSQCIDSWLLKTPICPICRT 120 >ref|XP_003633831.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Vitis vinifera] Length = 188 Score = 77.0 bits (188), Expect = 1e-12 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 1 DCAICLDSFREGDNCRKIPICKHLFHSNCVDRWIGRKPNCPVCRTRVD 144 DCA+CLD+F+ GD CR +P+C H FH+ CVD W+ + P CP+CRT D Sbjct: 74 DCAVCLDNFKMGDKCRLLPLCNHSFHAQCVDSWLLKTPICPICRTSAD 121 >ref|XP_002438223.1| hypothetical protein SORBIDRAFT_10g009860 [Sorghum bicolor] gi|241916446|gb|EER89590.1| hypothetical protein SORBIDRAFT_10g009860 [Sorghum bicolor] Length = 168 Score = 76.3 bits (186), Expect = 3e-12 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = +1 Query: 1 DCAICLDSFREGDNCRKIPICKHLFHSNCVDRWIGRKPNCPVCRTRVDLDPPGGD 165 DCA+CL++F+ GD CR++P C+H FH+ CVD W+ + CPVCR V PP G+ Sbjct: 85 DCAVCLEAFQAGDRCRQLPRCEHCFHAECVDSWLRKSSKCPVCRADVVDRPPKGE 139 >ref|XP_004151031.1| PREDICTED: putative RING-H2 finger protein ATL53-like [Cucumis sativus] gi|449521203|ref|XP_004167619.1| PREDICTED: putative RING-H2 finger protein ATL53-like [Cucumis sativus] Length = 162 Score = 74.7 bits (182), Expect = 7e-12 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +1 Query: 1 DCAICLDSFREGDNCRKIPICKHLFHSNCVDRWIGRKPNCPVCRTRV 141 DC+ICLD F EG+ CR +P CKH+FH C+DRW+ + NCPVCR+ V Sbjct: 106 DCSICLDEFTEGEICRMLPKCKHVFHRFCIDRWLPNERNCPVCRSPV 152