BLASTX nr result
ID: Salvia21_contig00021861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021861 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|35... 55 6e-06 gb|AET22503.1| hypothetical protein [Solanum lycopersicum] 55 6e-06 >gb|AET22504.1| hypothetical protein [Solanum lycopersicum] gi|356600308|gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium] Length = 886 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = -3 Query: 295 FYEFPDEVVKLIQLTYLGLTCDANLPPSISRLWKLSYLIVHRHLSIKW-TVDESYLPVEI 119 FY FP V+KL+ L YL L+ ++ LP SIS+L L LI++ W T + LP+E+ Sbjct: 573 FYGFPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY------WGTKEMRILPLEL 626 Query: 118 WDLQELKHLEIIG 80 W + L+H+ + G Sbjct: 627 WKMPILRHIHVKG 639 >gb|AET22503.1| hypothetical protein [Solanum lycopersicum] Length = 888 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = -3 Query: 295 FYEFPDEVVKLIQLTYLGLTCDANLPPSISRLWKLSYLIVHRHLSIKW-TVDESYLPVEI 119 FY FP V+KL+ L YL L+ ++ LP SIS+L L LI++ W T + LP+E+ Sbjct: 575 FYGFPIHVIKLVHLRYLALSINSELPRSISKLKSLQTLIIY------WGTKEMRILPLEL 628 Query: 118 WDLQELKHLEIIG 80 W + L+H+ + G Sbjct: 629 WKMPILRHIHVKG 641