BLASTX nr result
ID: Salvia21_contig00021818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021818 (1156 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002964343.1| hypothetical protein SELMODRAFT_438700 [Sela... 58 4e-06 >ref|XP_002964343.1| hypothetical protein SELMODRAFT_438700 [Selaginella moellendorffii] gi|300168072|gb|EFJ34676.1| hypothetical protein SELMODRAFT_438700 [Selaginella moellendorffii] Length = 236 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1066 ILYLFRACYGVLRFVMENGAKGCEVIVSGK 1155 +LY RACYGVLRF+ME+GAKGCEVIVSGK Sbjct: 118 VLYFVRACYGVLRFIMESGAKGCEVIVSGK 147