BLASTX nr result
ID: Salvia21_contig00021816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021816 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567205.2| zinc knuckle (CCHC-type) family protein [Arabid... 55 8e-06 gb|AAB62847.1| contains similarity to gag proteins [Arabidopsis ... 55 8e-06 >ref|NP_567205.2| zinc knuckle (CCHC-type) family protein [Arabidopsis thaliana] gi|26451026|dbj|BAC42619.1| unknown protein [Arabidopsis thaliana] gi|29028884|gb|AAO64821.1| At4g00980 [Arabidopsis thaliana] gi|332656563|gb|AEE81963.1| zinc knuckle (CCHC-type) family protein [Arabidopsis thaliana] Length = 488 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +1 Query: 1 TVLQILRASELETVTEFGVRSGAALRLGFELSGLNHRLLVRQLVDSFLLSTAAEIL 168 TV IL S+++ +TEF +R A+ +LG +LSG NH+ LVR +++ FLLST E L Sbjct: 23 TVKSILSESDMDQMTEFKLRLDASAKLGIDLSGTNHKKLVRDVLEVFLLSTPGEAL 78 >gb|AAB62847.1| contains similarity to gag proteins [Arabidopsis thaliana] gi|7267595|emb|CAB80907.1| AT4g00980 [Arabidopsis thaliana] Length = 462 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +1 Query: 1 TVLQILRASELETVTEFGVRSGAALRLGFELSGLNHRLLVRQLVDSFLLSTAAEIL 168 TV IL S+++ +TEF +R A+ +LG +LSG NH+ LVR +++ FLLST E L Sbjct: 23 TVKSILSESDMDQMTEFKLRLDASAKLGIDLSGTNHKKLVRDVLEVFLLSTPGEAL 78