BLASTX nr result
ID: Salvia21_contig00021490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021490 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20033.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002268032.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-12 ref|XP_003625825.1| Pentatricopeptide repeat-containing protein ... 76 3e-12 ref|XP_002528752.1| pentatricopeptide repeat-containing protein,... 75 7e-12 ref|XP_004140672.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 >emb|CBI20033.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +2 Query: 146 AITPQDLLHFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHFTLEYMVRTL 301 + TPQDLL FLK++L +HP SH D H+F +AAT+DSFRHDH T E+MV+TL Sbjct: 90 SFTPQDLLIFLKNKLHYHPKFSHFDLHIFTWAATIDSFRHDHSTYEWMVKTL 141 >ref|XP_002268032.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Vitis vinifera] Length = 480 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/52 (63%), Positives = 42/52 (80%) Frame = +2 Query: 146 AITPQDLLHFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHFTLEYMVRTL 301 + TPQDLL FLK++L +HP SH D H+F +AAT+DSFRHDH T E+MV+TL Sbjct: 59 SFTPQDLLIFLKNKLHYHPKFSHFDLHIFTWAATIDSFRHDHSTYEWMVKTL 110 >ref|XP_003625825.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500840|gb|AES82043.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 485 Score = 75.9 bits (185), Expect = 3e-12 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +2 Query: 149 ITPQDLLHFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHFTLEYMVRTL 301 +TPQ L HFLKS+L HHP+ +H DFHLF +A+TLD+F H+H + E+M RTL Sbjct: 58 LTPQTLTHFLKSKLHHHPSFTHFDFHLFSWASTLDTFSHNHTSYEWMTRTL 108 >ref|XP_002528752.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531846|gb|EEF33664.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 371 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = +2 Query: 149 ITPQDLLHFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHFTLEYMVRTL 301 ITP +LLHFLKS+L +HP SH D +F +A+T+DSFRHDH T E+M RTL Sbjct: 68 ITPHNLLHFLKSKLHYHPLFSHYDLLIFNWASTIDSFRHDHSTFEWMTRTL 118 >ref|XP_004140672.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Cucumis sativus] gi|449487417|ref|XP_004157616.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Cucumis sativus] Length = 486 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +2 Query: 152 TPQDLLHFLKSRLRHHPTLSHLDFHLFRYAATLDSFRHDHFTLEYMVRTL 301 TP LLHFLKS+L HP +H DFH+F +A+T+DSFRHDH T +M RTL Sbjct: 65 TPNSLLHFLKSKLHFHPKFTHYDFHVFNWASTIDSFRHDHSTFAWMARTL 114