BLASTX nr result
ID: Salvia21_contig00021466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021466 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590986.1| Transcriptional regulator ATRX [Medicago tru... 71 1e-10 ref|XP_004155137.1| PREDICTED: transcriptional regulator ATRX-li... 63 3e-08 ref|XP_004152865.1| PREDICTED: uncharacterized protein LOC101218... 63 3e-08 ref|XP_002522001.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_003555577.1| PREDICTED: transcriptional regulator ATRX-li... 59 5e-07 >ref|XP_003590986.1| Transcriptional regulator ATRX [Medicago truncatula] gi|355480034|gb|AES61237.1| Transcriptional regulator ATRX [Medicago truncatula] Length = 1653 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +1 Query: 52 RYGLRHCTNLAHLLTLRSQQIKAGGHAICGECARVLHWEDLQ 177 R+ R CTNLAHLLTLRSQ+IK GG+ +CGECARV+ WEDL+ Sbjct: 1611 RFTKRQCTNLAHLLTLRSQRIKIGGYTVCGECARVVRWEDLK 1652 >ref|XP_004155137.1| PREDICTED: transcriptional regulator ATRX-like [Cucumis sativus] Length = 366 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = +1 Query: 22 LERARQRHQYRYGLRHCTNLAHLLTLRSQQIKAGGHAICGECARVLHWEDLQPDPR 189 ++ A+ R + R+ R CTNL+HLLTLRSQ K G +CGECA+ + WEDL D + Sbjct: 308 IDLAQSRARNRFVSRKCTNLSHLLTLRSQGTKVGCSTVCGECAQEISWEDLNRDAK 363 >ref|XP_004152865.1| PREDICTED: uncharacterized protein LOC101218346 [Cucumis sativus] Length = 1628 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = +1 Query: 22 LERARQRHQYRYGLRHCTNLAHLLTLRSQQIKAGGHAICGECARVLHWEDLQPDPR 189 ++ A+ R + R+ R CTNL+HLLTLRSQ K G +CGECA+ + WEDL D + Sbjct: 1570 IDLAQSRARNRFVSRKCTNLSHLLTLRSQGTKVGCSTVCGECAQEISWEDLNRDAK 1625 >ref|XP_002522001.1| conserved hypothetical protein [Ricinus communis] gi|223538805|gb|EEF40405.1| conserved hypothetical protein [Ricinus communis] Length = 1447 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +1 Query: 64 RHCTNLAHLLTLRSQQIKAGGHAICGECARVLHWEDLQPDPR 189 R CTNL+HLLTLRSQ K G +CGECA+ + WEDL D R Sbjct: 1403 RKCTNLSHLLTLRSQGTKVGCTTVCGECAQEISWEDLNKDSR 1444 >ref|XP_003555577.1| PREDICTED: transcriptional regulator ATRX-like [Glycine max] Length = 1485 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 52 RYGLRHCTNLAHLLTLRSQQIKAGGHAICGECARVLHWEDLQ 177 R+ R CTNLAH+LTLRSQ K G +CGECA+ + WEDL+ Sbjct: 1442 RFTTRKCTNLAHMLTLRSQGTKFGCSTVCGECAQEIRWEDLK 1483