BLASTX nr result
ID: Salvia21_contig00021327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021327 (874 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14900.3| unnamed protein product [Vitis vinifera] 74 3e-11 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 74 3e-11 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 72 2e-10 ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|2... 72 2e-10 ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing... 71 4e-10 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = -1 Query: 316 RQFKLKAQQDRRVNDARWRLLVKKVVSARTISSLSLPKRKGVDEPRIVL-HPHRVRSFRV 140 RQFKLKAQQ ++ DARW+LLV+KVVSA+ +SSLSLPKRK +EPR L H H + SFR+ Sbjct: 288 RQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 347 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 74.3 bits (181), Expect = 3e-11 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = -1 Query: 316 RQFKLKAQQDRRVNDARWRLLVKKVVSARTISSLSLPKRKGVDEPRIVL-HPHRVRSFRV 140 RQFKLKAQQ ++ DARW+LLV+KVVSA+ +SSLSLPKRK +EPR L H H + SFR+ Sbjct: 292 RQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFRL 351 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/59 (55%), Positives = 47/59 (79%) Frame = -1 Query: 316 RQFKLKAQQDRRVNDARWRLLVKKVVSARTISSLSLPKRKGVDEPRIVLHPHRVRSFRV 140 RQFKLK Q +++ +DA W+LLV+KVVSAR +SSLSLPKRK ++ + +H H +R+FR+ Sbjct: 305 RQFKLKMQHEKKGDDALWKLLVRKVVSARVLSSLSLPKRKREEQLKETIHDHGIRTFRL 363 >ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|222859366|gb|EEE96913.1| predicted protein [Populus trichocarpa] Length = 364 Score = 72.0 bits (175), Expect = 2e-10 Identities = 40/78 (51%), Positives = 50/78 (64%) Frame = -1 Query: 376 SQSTTVPFCFNHLKFGMFCHRQFKLKAQQDRRVNDARWRLLVKKVVSARTISSLSLPKRK 197 + S VP C RQFKLK Q++RR ++ W LLVKKV SAR +SSLSLPKRK Sbjct: 298 TDSCRVPLC-----------RQFKLKMQRERRGDETLWSLLVKKVASARVMSSLSLPKRK 346 Query: 196 GVDEPRIVLHPHRVRSFR 143 +EPR +H H +R+FR Sbjct: 347 R-EEPRETIHDHGIRNFR 363 >ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Glycine max] Length = 346 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/82 (43%), Positives = 52/82 (63%) Frame = -1 Query: 385 HLVSQSTTVPFCFNHLKFGMFCHRQFKLKAQQDRRVNDARWRLLVKKVVSARTISSLSLP 206 H S VPFC RQF+L+ QQ++R +DA+W+LL +KV SA+ +SSLSLP Sbjct: 275 HDTDSSCKVPFC-----------RQFQLRMQQEKRKDDAKWKLLARKVASAKVMSSLSLP 323 Query: 205 KRKGVDEPRIVLHPHRVRSFRV 140 KRK +E R+ + +RSF++ Sbjct: 324 KRKRDEETRVTMDNPGIRSFKL 345