BLASTX nr result
ID: Salvia21_contig00021295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00021295 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283167.1| PREDICTED: probable inactive receptor kinase... 69 5e-10 ref|NP_569046.1| putative inactive receptor kinase [Arabidopsis ... 69 7e-10 dbj|BAB10954.1| receptor protein kinase-like protein [Arabidopsi... 69 7e-10 ref|XP_002865018.1| hypothetical protein ARALYDRAFT_496879 [Arab... 69 7e-10 ref|XP_002533262.1| receptor protein kinase, putative [Ricinus c... 69 7e-10 >ref|XP_002283167.1| PREDICTED: probable inactive receptor kinase At5g67200 isoform 1 [Vitis vinifera] Length = 671 Score = 68.9 bits (167), Expect = 5e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 105 FKSTADLDNRLLYTTNERFDFCQWRGVKCAQGRVV 1 FK+ ADLDN+LLYT NERFD+CQWRGVKC QGRVV Sbjct: 49 FKAKADLDNKLLYTLNERFDYCQWRGVKCVQGRVV 83 >ref|NP_569046.1| putative inactive receptor kinase [Arabidopsis thaliana] gi|75163506|sp|Q93Y06.1|Y5720_ARATH RecName: Full=Probable inactive receptor kinase At5g67200; Flags: Precursor gi|16649055|gb|AAL24379.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|28059128|gb|AAO30018.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|332010930|gb|AED98313.1| putative inactive receptor kinase [Arabidopsis thaliana] Length = 669 Score = 68.6 bits (166), Expect = 7e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 105 FKSTADLDNRLLYTTNERFDFCQWRGVKCAQGRVV 1 FKSTADLDN+LLY+ ER+D+CQWRGVKCAQGR+V Sbjct: 41 FKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIV 75 >dbj|BAB10954.1| receptor protein kinase-like protein [Arabidopsis thaliana] Length = 651 Score = 68.6 bits (166), Expect = 7e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 105 FKSTADLDNRLLYTTNERFDFCQWRGVKCAQGRVV 1 FKSTADLDN+LLY+ ER+D+CQWRGVKCAQGR+V Sbjct: 41 FKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIV 75 >ref|XP_002865018.1| hypothetical protein ARALYDRAFT_496879 [Arabidopsis lyrata subsp. lyrata] gi|297310853|gb|EFH41277.1| hypothetical protein ARALYDRAFT_496879 [Arabidopsis lyrata subsp. lyrata] Length = 667 Score = 68.6 bits (166), Expect = 7e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 105 FKSTADLDNRLLYTTNERFDFCQWRGVKCAQGRVV 1 FKSTADLDN+LLY+ ER+D+CQWRGVKCAQGR+V Sbjct: 38 FKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIV 72 >ref|XP_002533262.1| receptor protein kinase, putative [Ricinus communis] gi|223526918|gb|EEF29124.1| receptor protein kinase, putative [Ricinus communis] Length = 635 Score = 68.6 bits (166), Expect = 7e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 105 FKSTADLDNRLLYTTNERFDFCQWRGVKCAQGRVV 1 FKS ADLDN+LLYT +ERFD+CQW+GVKCAQGRVV Sbjct: 37 FKSNADLDNKLLYTLHERFDYCQWQGVKCAQGRVV 71