BLASTX nr result
ID: Salvia21_contig00020883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020883 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex ob... 59 4e-07 gb|AEK84226.1| cysteine protease inhibitor [Cucurbita maxima] 59 5e-07 gb|ABG81097.1| cysteine proteinase inhibitor [Pelargonium x hort... 59 5e-07 ref|XP_004144108.1| PREDICTED: cysteine proteinase inhibitor 6-l... 58 9e-07 ref|XP_004144107.1| PREDICTED: cysteine proteinase inhibitor 6-l... 58 9e-07 >emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex obtusifolius] Length = 99 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 206 DGGKDKVYEAKVWVQSWMNFKQLEEFKPLGD 114 DGGK KVYEAKVWV+ WMNFKQ++EFK LGD Sbjct: 64 DGGKKKVYEAKVWVKPWMNFKQVQEFKLLGD 94 >gb|AEK84226.1| cysteine protease inhibitor [Cucurbita maxima] Length = 101 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 206 DGGKDKVYEAKVWVQSWMNFKQLEEFKPLGDASICSS 96 DGG+ KVYEAK+WV+ W NFKQL+EFK +GD S+ SS Sbjct: 64 DGGQKKVYEAKIWVKVWENFKQLQEFKLVGDGSVGSS 100 >gb|ABG81097.1| cysteine proteinase inhibitor [Pelargonium x hortorum] Length = 98 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 206 DGGKDKVYEAKVWVQSWMNFKQLEEFKPLGDAS 108 DG K K+YEAKVW + WMNFK+L+EFKP+GDAS Sbjct: 64 DGDKKKLYEAKVWEKPWMNFKELQEFKPVGDAS 96 >ref|XP_004144108.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 2 [Cucumis sativus] gi|449493534|ref|XP_004159336.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 2 [Cucumis sativus] Length = 101 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 206 DGGKDKVYEAKVWVQSWMNFKQLEEFKPLGDASICSS 96 +GG+ KVYEAK+WV+ W NFKQL+EFK GD S+ SS Sbjct: 64 EGGQKKVYEAKIWVKQWQNFKQLQEFKLAGDGSVGSS 100 >ref|XP_004144107.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 1 [Cucumis sativus] gi|449493532|ref|XP_004159335.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 1 [Cucumis sativus] Length = 110 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 206 DGGKDKVYEAKVWVQSWMNFKQLEEFKPLGDASICSS 96 +GG+ KVYEAK+WV+ W NFKQL+EFK GD S+ SS Sbjct: 73 EGGQKKVYEAKIWVKQWQNFKQLQEFKLAGDGSVGSS 109