BLASTX nr result
ID: Salvia21_contig00020669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020669 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] 193 1e-47 pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Ar... 192 3e-47 ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819... 192 3e-47 ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|111... 184 9e-45 ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb... 181 7e-44 >gb|ABL67654.1| putative H-type thioredoxin [Citrus hybrid cultivar] Length = 119 Score = 193 bits (490), Expect = 1e-47 Identities = 90/107 (84%), Positives = 100/107 (93%) Frame = +3 Query: 51 QVIGCHTDATWNEQLQKANENKKLVVVDFTASWCGPCRFIAPFFAELAKKFPSVMFLKVD 230 QVIGCHT WNEQLQK+NE K+LVVVDFTASWCGPCRFIAPF AELAKK P+V+FLKVD Sbjct: 8 QVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVD 67 Query: 231 IDELKSVASDWAVEAMPTFIFLKEGKILDTIVGAKKEELQQTIAKHL 371 +DELKSVA+DWAVEAMPTF+FLKEGKI+D +VG+KKEELQQTIAKHL Sbjct: 68 VDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHL 114 >pdb|1XFL|A Chain A, Solution Structure Of Thioredoxin H1 From Arabidopsis Thaliana Length = 124 Score = 192 bits (487), Expect = 3e-47 Identities = 90/107 (84%), Positives = 99/107 (92%) Frame = +3 Query: 51 QVIGCHTDATWNEQLQKANENKKLVVVDFTASWCGPCRFIAPFFAELAKKFPSVMFLKVD 230 QVI CHT TWNEQLQKANE+K LVVVDFTASWCGPCRFIAPFFA+LAKK P+V+FLKVD Sbjct: 17 QVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVD 76 Query: 231 IDELKSVASDWAVEAMPTFIFLKEGKILDTIVGAKKEELQQTIAKHL 371 DELKSVASDWA++AMPTF+FLKEGKILD +VGAKK+ELQ TIAKHL Sbjct: 77 TDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 123 >ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana] gi|297819804|ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|267122|sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 1; Short=AtTRX1 gi|16552|emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana] gi|1388080|gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana] gi|6562255|emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana] gi|21617958|gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana] gi|297323623|gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. lyrata] gi|332645218|gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana] Length = 114 Score = 192 bits (487), Expect = 3e-47 Identities = 90/107 (84%), Positives = 99/107 (92%) Frame = +3 Query: 51 QVIGCHTDATWNEQLQKANENKKLVVVDFTASWCGPCRFIAPFFAELAKKFPSVMFLKVD 230 QVI CHT TWNEQLQKANE+K LVVVDFTASWCGPCRFIAPFFA+LAKK P+V+FLKVD Sbjct: 7 QVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVD 66 Query: 231 IDELKSVASDWAVEAMPTFIFLKEGKILDTIVGAKKEELQQTIAKHL 371 DELKSVASDWA++AMPTF+FLKEGKILD +VGAKK+ELQ TIAKHL Sbjct: 67 TDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 113 >ref|XP_002534131.1| Thioredoxin H-type [Ricinus communis] gi|11135282|sp|Q43636.1|TRXH_RICCO RecName: Full=Thioredoxin H-type; Short=Trx-H gi|1255954|emb|CAA94534.1| thioredoxin [Ricinus communis] gi|223525803|gb|EEF28248.1| Thioredoxin H-type [Ricinus communis] Length = 118 Score = 184 bits (466), Expect = 9e-45 Identities = 84/107 (78%), Positives = 96/107 (89%) Frame = +3 Query: 51 QVIGCHTDATWNEQLQKANENKKLVVVDFTASWCGPCRFIAPFFAELAKKFPSVMFLKVD 230 QVIGCHT WNEQLQK N+ K L+VVDFTASWCGPCRFIAPF AELAKK P+V FLKVD Sbjct: 7 QVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVD 66 Query: 231 IDELKSVASDWAVEAMPTFIFLKEGKILDTIVGAKKEELQQTIAKHL 371 +DELK+VA +WAVE+MPTF+FLKEGKI+D +VGAKK+ELQQTIAKH+ Sbjct: 67 VDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKHM 113 >ref|NP_001237535.1| thioredoxin h1 [Glycine max] gi|157781191|gb|ABV71991.1| thioredoxin h1 [Glycine max] Length = 120 Score = 181 bits (458), Expect = 7e-44 Identities = 82/107 (76%), Positives = 95/107 (88%) Frame = +3 Query: 51 QVIGCHTDATWNEQLQKANENKKLVVVDFTASWCGPCRFIAPFFAELAKKFPSVMFLKVD 230 QVI CHT WN+QLQK NE+KKL+VVDFTASWCGPCRFIAPF AELAKKF SV+FLKVD Sbjct: 9 QVISCHTVEEWNDQLQKGNESKKLIVVDFTASWCGPCRFIAPFLAELAKKFTSVIFLKVD 68 Query: 231 IDELKSVASDWAVEAMPTFIFLKEGKILDTIVGAKKEELQQTIAKHL 371 +DELKSV+ DWA+EAMPTF+F+KEG +LD +VGAKK+ELQQ I KH+ Sbjct: 69 VDELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKHV 115