BLASTX nr result
ID: Salvia21_contig00020551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020551 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAG13451.1| beta-glucosidase [Rosa hybrid cultivar] 60 2e-07 gb|AEN94900.1| beta-glucosidase [Malus x domestica] 59 5e-07 emb|CAG14979.1| non-cyanogenic beta-glucosidase [Cicer arietinum] 57 1e-06 gb|AES93119.1| putative strictosidine beta-D-glucosidase [Campto... 57 1e-06 gb|AFB70991.1| strictosidine beta-D-glucosidase, partial [Mitrag... 57 2e-06 >dbj|BAG13451.1| beta-glucosidase [Rosa hybrid cultivar] Length = 532 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 374 GIEPFVTLVHLDVPQALQDAYGGFLSSQIVGHFVDFA 484 G++PFVTL H D+PQAL+D YGGFLS QIV HF D+A Sbjct: 149 GLKPFVTLFHWDLPQALEDEYGGFLSPQIVNHFQDYA 185 >gb|AEN94900.1| beta-glucosidase [Malus x domestica] Length = 535 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 374 GIEPFVTLVHLDVPQALQDAYGGFLSSQIVGHFVDFA 484 GI+PFVT+ H DVPQAL+DAYGGFLS+ IV F D+A Sbjct: 154 GIQPFVTIFHWDVPQALEDAYGGFLSASIVDDFKDYA 190 >emb|CAG14979.1| non-cyanogenic beta-glucosidase [Cicer arietinum] Length = 511 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 377 IEPFVTLVHLDVPQALQDAYGGFLSSQIVGHFVDFA 484 IEPFVTL H D+PQAL+D YGGFLSSQI+ F D+A Sbjct: 144 IEPFVTLFHWDLPQALEDEYGGFLSSQIIDDFRDYA 179 >gb|AES93119.1| putative strictosidine beta-D-glucosidase [Camptotheca acuminata] Length = 532 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 374 GIEPFVTLVHLDVPQALQDAYGGFLSSQIVGHFVDFA 484 GIEPFVTL H D+PQAL++ YGGFLS +I+ +VDFA Sbjct: 130 GIEPFVTLFHWDLPQALENEYGGFLSPRIIADYVDFA 166 >gb|AFB70991.1| strictosidine beta-D-glucosidase, partial [Mitragyna speciosa] Length = 257 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 374 GIEPFVTLVHLDVPQALQDAYGGFLSSQIVGHFVDF 481 GIEP+VTL H DVPQAL+D YGGFLSSQIV F ++ Sbjct: 83 GIEPYVTLFHWDVPQALEDKYGGFLSSQIVDDFREY 118