BLASTX nr result
ID: Salvia21_contig00020440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020440 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing pr... 65 6e-09 dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 63 2e-08 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 63 3e-08 ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244... 61 1e-07 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|222872679|gb|EEF09810.1| predicted protein [Populus trichocarpa] Length = 190 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = +1 Query: 103 VNHFSHRHPLEASEIDEDDEKSVCSGCEHDIVGPAYACTKPTCNFLLHHLC 255 V HFSH HPL ++ E++E S+CSGCE D+ G AY CTK TC+F LH C Sbjct: 17 VKHFSHSHPLRPVDVKEEEE-SICSGCELDLSGSAYKCTKSTCDFFLHKSC 66 >ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/61 (45%), Positives = 37/61 (60%) Frame = +1 Query: 79 SKREKQLQVNHFSHRHPLEASEIDEDDEKSVCSGCEHDIVGPAYACTKPTCNFLLHHLCS 258 S + + V H SH HPL E+DE +CSGCEHD++G A+ CTK C++ LH C Sbjct: 3 SGKTNRPSVRHPSHNHPLRVFNSKEEDE-IICSGCEHDLIGQAFKCTKSECDYFLHKSCF 61 Query: 259 D 261 D Sbjct: 62 D 62 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +1 Query: 103 VNHFSHRHPLEASEIDEDDEKSVCSGCEHDIVGPAYACTKPTCNFLLHHLC 255 + HFSH H LE SE+ E +E +CSGCE+ + G +Y CTKP C F LH C Sbjct: 1 MKHFSHPHALELSEVQETNE-IICSGCENKLSGISYKCTKPNCKFTLHKSC 50 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +1 Query: 103 VNHFSHRHPLEASEIDEDDEKSVCSGCEHDIVGPAYACTKPTCNFLLHHLC 255 V HFSH HPL +++ ED+E +C GCE D+ G AY C+K C FLLH C Sbjct: 16 VKHFSHSHPLRPADVKEDEE-IICFGCELDLSGSAYKCSKSKCVFLLHKSC 65 >ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244183 [Vitis vinifera] Length = 309 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +1 Query: 103 VNHFSHRHPLEASEIDEDDEKSVCSGCEHDIVGPAYACTKPTCNFLLHHLC 255 V HFSH+HPL +E+ E+D VCSGCE + G AY CT C+FLLH C Sbjct: 4 VKHFSHKHPLCHAEVKEEDG-FVCSGCELGLSGSAYKCTISNCDFLLHDSC 53