BLASTX nr result
ID: Salvia21_contig00020394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020394 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32873.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002278827.1| PREDICTED: zinc finger and SCAN domain-conta... 57 2e-06 >emb|CBI32873.3| unnamed protein product [Vitis vinifera] Length = 390 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 371 RPRGGRKRKYPVIETLMRKRIVPPSESELAMNEGQDYPSWQFSN 240 RP+GGRKRK P IE L+RKR+ PPS+S+ + +G +Y SW S+ Sbjct: 342 RPKGGRKRKSPPIEALLRKRVTPPSQSDSILCQGPEYLSWLLSD 385 >ref|XP_002278827.1| PREDICTED: zinc finger and SCAN domain-containing protein 10-like [Vitis vinifera] Length = 370 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 371 RPRGGRKRKYPVIETLMRKRIVPPSESELAMNEGQDYPSWQFSN 240 RP+GGRKRK P IE L+RKR+ PPS+S+ + +G +Y SW S+ Sbjct: 322 RPKGGRKRKSPPIEALLRKRVTPPSQSDSILCQGPEYLSWLLSD 365