BLASTX nr result
ID: Salvia21_contig00020281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00020281 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588752.1| AFG1-family ATPase [Medicago truncatula] gi|... 62 1e-11 ref|XP_002515532.1| atpase n2b, putative [Ricinus communis] gi|2... 55 1e-11 ref|XP_003561443.1| PREDICTED: lactation elevated protein 1-like... 54 5e-11 gb|AAO20064.1| putative AFG1-like ATPase [Oryza sativa Japonica ... 53 1e-10 gb|EEC76553.1| hypothetical protein OsI_14358 [Oryza sativa Indi... 53 1e-10 >ref|XP_003588752.1| AFG1-family ATPase [Medicago truncatula] gi|355477800|gb|AES59003.1| AFG1-family ATPase [Medicago truncatula] Length = 830 Score = 62.0 bits (149), Expect(2) = 1e-11 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -3 Query: 236 EKKLDLIVGQCPTAPPAPKGLYIYGNVGSGSLLHFYSIFNVS*LV*YSLASKLLHDPSRS 57 EKKLD +VG+ PTAPPAPKGLYIYGNVGSG+ L + + + + ++H P Sbjct: 173 EKKLDSLVGRRPTAPPAPKGLYIYGNVGSGTYLLLFVFWILVTSFMSLVRVNVMHYPDSL 232 Query: 56 FRK 48 FRK Sbjct: 233 FRK 235 Score = 32.3 bits (72), Expect(2) = 1e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 49 KTMLMEMFYGATEGIV 2 KTMLM+MFY ATEGIV Sbjct: 235 KTMLMDMFYSATEGIV 250 >ref|XP_002515532.1| atpase n2b, putative [Ricinus communis] gi|223545476|gb|EEF46981.1| atpase n2b, putative [Ricinus communis] Length = 543 Score = 55.5 bits (132), Expect(2) = 1e-11 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 236 EKKLDLIVGQCPTAPPAPKGLYIYGNVGSGSLL 138 E+KLD +VG+ P APPAPKGLYIYGNVGSG + Sbjct: 123 ERKLDSVVGRRPIAPPAPKGLYIYGNVGSGKTM 155 Score = 38.5 bits (88), Expect(2) = 1e-11 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 55 SGKTMLMEMFYGATEGIV 2 SGKTMLM+MFYGATEGIV Sbjct: 151 SGKTMLMDMFYGATEGIV 168 >ref|XP_003561443.1| PREDICTED: lactation elevated protein 1-like [Brachypodium distachyon] Length = 613 Score = 54.3 bits (129), Expect(2) = 5e-11 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 236 EKKLDLIVGQCPTAPPAPKGLYIYGNVGSGSLL 138 EKKLD +VGQ P AP APKGLY+YGNVGSG + Sbjct: 164 EKKLDTLVGQKPVAPVAPKGLYLYGNVGSGKTM 196 Score = 37.7 bits (86), Expect(2) = 5e-11 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -1 Query: 55 SGKTMLMEMFYGATEGIV 2 SGKTMLM+MFYGATEG++ Sbjct: 192 SGKTMLMDMFYGATEGVI 209 >gb|AAO20064.1| putative AFG1-like ATPase [Oryza sativa Japonica Group] Length = 740 Score = 53.1 bits (126), Expect(2) = 1e-10 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 236 EKKLDLIVGQCPTAPPAPKGLYIYGNVGSGSLL 138 EKKLD +VGQ P AP APKG+Y+YGNVGSG + Sbjct: 293 EKKLDTLVGQKPVAPIAPKGIYLYGNVGSGKTM 325 Score = 37.4 bits (85), Expect(2) = 1e-10 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -1 Query: 55 SGKTMLMEMFYGATEGIV 2 SGKTMLM+MFYGATEG++ Sbjct: 321 SGKTMLMDMFYGATEGLI 338 >gb|EEC76553.1| hypothetical protein OsI_14358 [Oryza sativa Indica Group] Length = 613 Score = 53.1 bits (126), Expect(2) = 1e-10 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 236 EKKLDLIVGQCPTAPPAPKGLYIYGNVGSGSLL 138 EKKLD +VGQ P AP APKG+Y+YGNVGSG + Sbjct: 166 EKKLDTLVGQKPVAPIAPKGIYLYGNVGSGKTM 198 Score = 37.4 bits (85), Expect(2) = 1e-10 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -1 Query: 55 SGKTMLMEMFYGATEGIV 2 SGKTMLM+MFYGATEG++ Sbjct: 194 SGKTMLMDMFYGATEGLI 211