BLASTX nr result
ID: Salvia21_contig00019952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00019952 (694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 ... 58 2e-06 >gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 [Nicotiana tabacum] Length = 102 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/46 (58%), Positives = 35/46 (76%), Gaps = 3/46 (6%) Frame = +3 Query: 189 RWKLKS-SAGLRWKKR--FNLHLWFIDDVLFKVVSVFEAVCLVSAL 317 RW+ K+ S+GLRW K+ + LH WF+D LFK+VSVFEA+ LVS L Sbjct: 46 RWRFKNLSSGLRWNKKSLYKLHHWFVDSFLFKIVSVFEAIALVSTL 91