BLASTX nr result
ID: Salvia21_contig00019502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00019502 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516734.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002516734.1| conserved hypothetical protein [Ricinus communis] gi|223544107|gb|EEF45632.1| conserved hypothetical protein [Ricinus communis] Length = 174 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -2 Query: 246 DNVATNAAAKTRHKLYWGLDTKERWERKSNM 154 DNVA + A K R KLYWGLDTKERWERK+NM Sbjct: 144 DNVAADHAPKKRQKLYWGLDTKERWERKANM 174