BLASTX nr result
ID: Salvia21_contig00018244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00018244 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE72877.1| cytochrome P450 [Verbena x hybrida] 64 1e-08 dbj|BAB32886.1| cytochrome P450 (CYP76C2) [Arabidopsis thaliana] 56 3e-06 ref|NP_182081.1| cytochrome P450 76C2 [Arabidopsis thaliana] gi|... 56 3e-06 ref|XP_002882021.1| CYP76C2 [Arabidopsis lyrata subsp. lyrata] g... 55 8e-06 >dbj|BAE72877.1| cytochrome P450 [Verbena x hybrida] Length = 494 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/57 (50%), Positives = 43/57 (75%) Frame = +3 Query: 30 VRHDEFSVKYLPASSNRWKMLRKVQRERLFSHAALEATQDIRRERLQKLTDYVTECS 200 V H +FS+ +LP N+W+ LRK+ +E++FS +L A+Q++R E+LQKL DYV ECS Sbjct: 111 VHHHKFSMGWLP-DDNQWRKLRKISKEQMFSVQSLNASQELRMEKLQKLGDYVQECS 166 >dbj|BAB32886.1| cytochrome P450 (CYP76C2) [Arabidopsis thaliana] Length = 174 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/57 (40%), Positives = 41/57 (71%) Frame = +3 Query: 30 VRHDEFSVKYLPASSNRWKMLRKVQRERLFSHAALEATQDIRRERLQKLTDYVTECS 200 + HD+ SV +LP SS+RW++LRK+ +LFS +EAT+ +R ++++L +++E S Sbjct: 56 INHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESS 112 >ref|NP_182081.1| cytochrome P450 76C2 [Arabidopsis thaliana] gi|5915832|sp|O64637.1|C76C2_ARATH RecName: Full=Cytochrome P450 76C2 gi|2979549|gb|AAC06158.1| putative cytochrome P450 [Arabidopsis thaliana] gi|17065048|gb|AAL32678.1| putative cytochrome P450 [Arabidopsis thaliana] gi|21387151|gb|AAM47979.1| putative cytochrome P450 [Arabidopsis thaliana] gi|330255478|gb|AEC10572.1| cytochrome P450 76C2 [Arabidopsis thaliana] Length = 512 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/57 (40%), Positives = 41/57 (71%) Frame = +3 Query: 30 VRHDEFSVKYLPASSNRWKMLRKVQRERLFSHAALEATQDIRRERLQKLTDYVTECS 200 + HD+ SV +LP SS+RW++LRK+ +LFS +EAT+ +R ++++L +++E S Sbjct: 114 INHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESS 170 >ref|XP_002882021.1| CYP76C2 [Arabidopsis lyrata subsp. lyrata] gi|297327860|gb|EFH58280.1| CYP76C2 [Arabidopsis lyrata subsp. lyrata] Length = 512 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/57 (42%), Positives = 39/57 (68%) Frame = +3 Query: 30 VRHDEFSVKYLPASSNRWKMLRKVQRERLFSHAALEATQDIRRERLQKLTDYVTECS 200 + H E SV +LP SS RW++LRK+ +LFS LEAT+ +R ++++L +++E S Sbjct: 114 INHHEVSVVWLPPSSPRWRLLRKLAATQLFSPQRLEATKTLRENKVKELVSFISESS 170