BLASTX nr result
ID: Salvia21_contig00018010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00018010 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636833.1| Cytochrome P450 [Medicago truncatula] gi|355... 56 3e-06 >ref|XP_003636833.1| Cytochrome P450 [Medicago truncatula] gi|355502768|gb|AES83971.1| Cytochrome P450 [Medicago truncatula] Length = 1639 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = +2 Query: 47 STSEEQATDHWPSLWWKAIPLKVSAFVWKGLLDRLPTKDNLIKRGILH 190 S S A H +W K +PLK+S F W+ L DRLPT +NLIKR ILH Sbjct: 1456 SNSNNLAVTHITEIWNKEVPLKISLFAWRLLRDRLPTTNNLIKRHILH 1503